Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P51178 (PLCD1_HUMAN)

Entry version 202 (22 Apr 2020)
Sequence version 2 (23 Sep 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1

Gene

PLCD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Essential for trophoblast and placental development.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+PROSITE-ProRule annotationNote: Binds 3 Ca2+ ions per subunit. Two of the Ca2+ ions are bound to the C2 domain.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei311PROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi312Calcium 1; catalyticBy similarity1
Metal bindingi341Calcium 1; catalyticBy similarity1
Metal bindingi343Calcium 1; catalyticBy similarity1
Active sitei356PROSITE-ProRule annotation1
Metal bindingi390Calcium 1; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei438SubstrateBy similarity1
Binding sitei440SubstrateBy similarity1
Binding sitei522SubstrateBy similarity1
Binding sitei549SubstrateBy similarity1
Metal bindingi651Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi653Calcium 2By similarity1
Metal bindingi677Calcium 2By similarity1
Metal bindingi706Calcium 3By similarity1
Metal bindingi707Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi708Calcium 3By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi153 – 1641PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi189 – 2002PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS07195-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.4.11 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001065

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-delta-1
Phospholipase C-III
Short name:
PLC-III
Phospholipase C-delta-1
Short name:
PLC-delta-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLCD1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9060 PLCD1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602142 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P51178

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Nail disorder, non-syndromic congenital, 3 (NDNC3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA nail disorder characterized by a white appearance of the nail plate (true leukonychia), the nail bed (pseudoleukonychia), or neither (apparent leukonychia). Leukonychia may involve all of the nail (leukonychia totalis) or only part of the nail (leukonychia partialis), or can appear as one or more transverse bands (leukonychia striata) or white spots (leukonychia punctata).
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_066399209T → R in NDNC3. 1 Publication1
Natural variantiVAR_066400574I → T in NDNC3. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		5333

MalaCards human disease database

More...MalaCardsi		PLCD1
MIMi151600 phenotype

Open Targets

More...OpenTargetsi		ENSG00000187091

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2387 Leukonychia totalis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33388

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P51178 Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3727

Drug and drug target database

More...DrugBanki		DB03401 1D-myo-inositol 1,4,5-trisphosphate
DB03956 Inositol 2,4,5-trisphosphate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PLCD1

Domain mapping of disease mutations (DMDM)

More...DMDMi		206729887

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000885041 – 7561-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1Add BLAST756

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi191O-linked (GlcNAc) serineBy similarity1
Glycosylationi193O-linked (GlcNAc) threonineBy similarity1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei457PhosphothreonineBy similarity1
Modified residuei460PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P51178

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P51178

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P51178

MaxQB - The MaxQuant DataBase

More...MaxQBi		P51178

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P51178

PeptideAtlas

More...PeptideAtlasi		P51178

PRoteomics IDEntifications database

More...PRIDEi		P51178

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		56300 [P51178-1]
56301 [P51178-2]

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00746030

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P51178

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P51178

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P51178

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000187091 Expressed in male germ cell and 224 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P51178 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P51178 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000187091 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111349, 20 interactors

Protein interaction database and analysis system

More...IntActi		P51178, 14 interactors

Molecular INTeraction database

More...MINTi		P51178

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000430344

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P51178

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P51178 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P51178

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini21 – 130PHPROSITE-ProRule annotationAdd BLAST110
Domaini140 – 175EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini176 – 211EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini296 – 440PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST145
Domaini492 – 609PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST118
Domaini611 – 737C2PROSITE-ProRule annotationAdd BLAST127

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni30 – 57Substrate bindingBy similarityAdd BLAST28

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0169 Eukaryota
ENOG410XPSW LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158392

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002738_0_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P51178

KEGG Orthology (KO)

More...KOi		K05857

Identification of Orthologs from Complete Genome Data

More...OMAi		VCQNLHI

Database of Orthologous Groups

More...OrthoDBi		368239at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P51178

TreeFam database of animal gene trees

More...TreeFami		TF313216

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001192 PI-PLC_fam
IPR028391 PLC-delta1
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...PANTHERi		PTHR10336 PTHR10336, 1 hit
PTHR10336:SF80 PTHR10336:SF80, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00390 PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00239 C2, 1 hit
SM00054 EFh, 2 hits
SM00233 PH, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50004 C2, 1 hit
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 2 hits
PS50003 PH_DOMAIN, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P51178-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSGRDFLTL HGLQDDEDLQ ALLKGSQLLK VKSSSWRRER FYKLQEDCKT 
        60         70         80         90        100
IWQESRKVMR TPESQLFSIE DIQEVRMGHR TEGLEKFARD VPEDRCFSIV 
       110        120        130        140        150
FKDQRNTLDL IAPSPADAQH WVLGLHKIIH HSGSMDQRQK LQHWIHSCLR 
       160        170        180        190        200
KADKNKDNKM SFKELQNFLK ELNIQVDDSY ARKIFRECDH SQTDSLEDEE 
       210        220        230        240        250
IEAFYKMLTQ RVEIDRTFAE AAGSGETLSV DQLVTFLQHQ QREEAAGPAL 
       260        270        280        290        300
ALSLIERYEP SETAKAQRQM TKDGFLMYLL SADGSAFSLA HRRVYQDMGQ 
       310        320        330        340        350
PLSHYLVSSS HNTYLLEDQL AGPSSTEAYI RALCKGCRCL ELDCWDGPNQ 
       360        370        380        390        400
EPIIYHGYTF TSKILFCDVL RAIRDYAFKA SPYPVILSLE NHCTLEQQRV 
       410        420        430        440        450
MARHLHAILG PMLLNRPLDG VTNSLPSPEQ LKGKILLKGK KLGGLLPPGG 
       460        470        480        490        500
EGGPEATVVS DEDEAAEMED EAVRSRVQHK PKEDKLRLAQ ELSDMVIYCK 
       510        520        530        540        550
SVHFGGFSSP GTPGQAFYEM ASFSENRALR LLQESGNGFV RHNVGHLSRI 
       560        570        580        590        600
YPAGWRTDSS NYSPVEMWNG GCQIVALNFQ TPGPEMDVYQ GRFQDNGACG 
       610        620        630        640        650
YVLKPAFLRD PNGTFNPRAL AQGPWWARKR LNIRVISGQQ LPKVNKNKNS 
       660        670        680        690        700
IVDPKVTVEI HGVSRDVASR QTAVITNNGF NPWWDTEFAF EVVVPDLALI 
       710        720        730        740        750
RFLVEDYDAS SKNDFIGQST IPLNSLKQGY RHVHLMSKNG DQHPSATLFV 

KISLQD
Length:756
Mass (Da):85,665
Last modified:September 23, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6C6FD7F89BA08C83
GO
Isoform 2 (identifier: P51178-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MDSGRDFLTLH → MQCLGIRSRSRSRELYLQERSLKVAALNGRRL

Show »
Length:777
Mass (Da):88,135
Checksum:i6260C76BE397266B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti224S → P in AAA73567 (PubMed:7890667).Curated1
Sequence conflicti264A → T in AAA73567 (PubMed:7890667).Curated1
Sequence conflicti591G → D in AAA73567 (PubMed:7890667).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_066399209T → R in NDNC3. 1 Publication1
Natural variantiVAR_046560257R → H. Corresponds to variant dbSNP:rs933135Ensembl.1
Natural variantiVAR_066400574I → T in NDNC3. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0429191 – 11MDSGRDFLTLH → MQCLGIRSRSRSRELYLQER SLKVAALNGRRL in isoform 2. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U09117 mRNA Translation: AAA73567.1
AK090774 mRNA Translation: BAG52226.1
AC144536 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64507.1
BC050382 mRNA Translation: AAH50382.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2671.1 [P51178-1]
CCDS46793.1 [P51178-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A55943

NCBI Reference Sequences

More...RefSeqi		NP_001124436.1, NM_001130964.1 [P51178-2]
NP_006216.2, NM_006225.3 [P51178-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000334661; ENSP00000335600; ENSG00000187091 [P51178-1]
ENST00000463876; ENSP00000430344; ENSG00000187091 [P51178-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5333

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5333

UCSC genome browser

More...UCSCi		uc003chm.4 human [P51178-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U09117 mRNA Translation: AAA73567.1
AK090774 mRNA Translation: BAG52226.1
AC144536 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64507.1
BC050382 mRNA Translation: AAH50382.2
CCDSiCCDS2671.1 [P51178-1]
CCDS46793.1 [P51178-2]
PIRiA55943
RefSeqiNP_001124436.1, NM_001130964.1 [P51178-2]
NP_006216.2, NM_006225.3 [P51178-1]

3D structure databases

SMRiP51178
ModBaseiSearch...

Protein-protein interaction databases

BioGridi111349, 20 interactors
IntActiP51178, 14 interactors
MINTiP51178
STRINGi9606.ENSP00000430344

Chemistry databases

BindingDBiP51178
ChEMBLiCHEMBL3727
DrugBankiDB03401 1D-myo-inositol 1,4,5-trisphosphate
DB03956 Inositol 2,4,5-trisphosphate
SwissLipidsiSLP:000001065

PTM databases

iPTMnetiP51178
PhosphoSitePlusiP51178
SwissPalmiP51178

Polymorphism and mutation databases

BioMutaiPLCD1
DMDMi206729887

2D gel databases

REPRODUCTION-2DPAGEiIPI00746030

Proteomic databases

EPDiP51178
jPOSTiP51178
MassIVEiP51178
MaxQBiP51178
PaxDbiP51178
PeptideAtlasiP51178
PRIDEiP51178
ProteomicsDBi56300 [P51178-1]
56301 [P51178-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4086 166 antibodies

Genome annotation databases

EnsembliENST00000334661; ENSP00000335600; ENSG00000187091 [P51178-1]
ENST00000463876; ENSP00000430344; ENSG00000187091 [P51178-2]
GeneIDi5333
KEGGihsa:5333
UCSCiuc003chm.4 human [P51178-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5333
DisGeNETi5333

GeneCards: human genes, protein and diseases

More...GeneCardsi		PLCD1
HGNCiHGNC:9060 PLCD1
HPAiENSG00000187091 Low tissue specificity
MalaCardsiPLCD1
MIMi151600 phenotype
602142 gene
neXtProtiNX_P51178
OpenTargetsiENSG00000187091
Orphaneti2387 Leukonychia totalis
PharmGKBiPA33388

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00940000158392
HOGENOMiCLU_002738_0_2_1
InParanoidiP51178
KOiK05857
OMAiVCQNLHI
OrthoDBi368239at2759
PhylomeDBiP51178
TreeFamiTF313216

Enzyme and pathway databases

BioCyciMetaCyc:HS07195-MONOMER
BRENDAi3.1.4.11 2681
ReactomeiR-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PLCD1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5333
PharosiP51178 Tchem

Protein Ontology

More...PROi		PR:P51178
RNActiP51178 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000187091 Expressed in male germ cell and 224 other tissues
ExpressionAtlasiP51178 baseline and differential
GenevisibleiP51178 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001192 PI-PLC_fam
IPR028391 PLC-delta1
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PTHR10336:SF80 PTHR10336:SF80, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00054 EFh, 2 hits
SM00233 PH, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 2 hits
PS50003 PH_DOMAIN, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCD1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P51178
Secondary accession number(s): B3KR14, Q86VN8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: September 23, 2008
Last modified: April 22, 2020
This is version 202 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again