Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gastrotropin

Gene

FABP6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes (By similarity). In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion (By similarity).By similarity2 Publications
Isoform 2: Essential for the survival of colon cancer cells to bile acid-induced apoptosis.1 Publication

GO - Molecular functioni

  • bile acid binding Source: InterPro
  • lipid binding Source: ProtInc

GO - Biological processi

Keywordsi

Biological processLipid transport, Transport
LigandLipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-159418 Recycling of bile acids and salts
R-HSA-163560 Triglyceride catabolism

Chemistry databases

SwissLipidsiSLP:000001518

Names & Taxonomyi

Protein namesi
Recommended name:
Gastrotropin
Short name:
GT
Alternative name(s):
Fatty acid-binding protein 6
Ileal lipid-binding protein
Short name:
ILBP
Intestinal 15 kDa protein
Short name:
I-15P
Intestinal bile acid-binding protein
Short name:
I-BABP
Gene namesi
Name:FABP6
Synonyms:ILBP, ILLBP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000170231.15
HGNCiHGNC:3561 FABP6
MIMi600422 gene
neXtProtiNX_P51161

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi2172
OpenTargetsiENSG00000170231
PharmGKBiPA27962

Chemistry databases

DrugBankiDB02659 Cholic Acid
DB02691 N-Cholylglycine
DB04348 Taurocholic Acid

Polymorphism and mutation databases

BioMutaiFABP6
DMDMi1708457

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000673802 – 128GastrotropinAdd BLAST127

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP51161
MaxQBiP51161
PaxDbiP51161
PeptideAtlasiP51161
PRIDEiP51161
ProteomicsDBi56292
56293 [P51161-2]

PTM databases

iPTMnetiP51161
PhosphoSitePlusiP51161

Expressioni

Tissue specificityi

Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level).3 Publications

Inductioni

Isoform 1 is up-regulated by chenodeoxycholic acid (CDCA) via the FXR transcription pathway. Isoform 2 is up-regulated by NF-kappa-B and in all stages of colorectal adenocarcinoma. Isoform 1 is not up-regulated in all stages of colorectal adenocarcinoma.1 Publication

Gene expression databases

BgeeiENSG00000170231 Expressed in 131 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_FABP6
ExpressionAtlasiP51161 baseline and differential
GenevisibleiP51161 HS

Organism-specific databases

HPAiCAB024713
HPA012601

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000377549

Structurei

Secondary structure

1128
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP51161
SMRiP51161
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP51161

Family & Domainsi

Domaini

Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. Can bind at least two ligands per molecule, however, the stoichiometry is debated.2 Publications

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4015 Eukaryota
ENOG4111US8 LUCA
GeneTreeiENSGT00390000012034
HOGENOMiHOG000004830
HOVERGENiHBG005633
InParanoidiP51161
KOiK08755
OMAiCDMETIG
OrthoDBiEOG091G16BV
PhylomeDBiP51161
TreeFamiTF330348

Family and domain databases

Gene3Di2.40.128.20, 1 hit
InterProiView protein in InterPro
IPR012674 Calycin
IPR000463 Fatty_acid-bd
IPR031257 Gastrotropin
IPR031259 ILBP
PANTHERiPTHR11955 PTHR11955, 1 hit
PTHR11955:SF69 PTHR11955:SF69, 1 hit
PRINTSiPR00178 FATTYACIDBP
SUPFAMiSSF50814 SSF50814, 1 hit
PROSITEiView protein in PROSITE
PS00214 FABP, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative promoter usage. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P51161-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFTGKFEME SEKNYDEFMK LLGISSDVIE KARNFKIVTE VQQDGQDFTW
60 70 80 90 100
SQHYSGGHTM TNKFTVGKES NIQTMGGKTF KATVQMEGGK LVVNFPNYHQ
110 120
TSEIVGDKLV EVSTIGGVTY ERVSKRLA
Length:128
Mass (Da):14,371
Last modified:January 23, 2007 - v2
Checksum:i173CBC5DBEDADDE1
GO
Isoform 2 (identifier: P51161-2) [UniParc]FASTAAdd to basket
Also known as: IBABP-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKTVTMMMVVEMQALTQVLRAVLSACTWVSRKGDLQRMKQTHKGKPPSSM

Show »
Length:177
Mass (Da):19,874
Checksum:i0ACBAE8E7DF65BF0
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YB64H0YB64_HUMAN
Gastrotropin
FABP6
38Annotation score:

Sequence cautioni

The sequence AAH22489 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03957833R → H1 PublicationCorresponds to variant dbSNP:rs17856662Ensembl.1
Natural variantiVAR_03957955S → Y1 PublicationCorresponds to variant dbSNP:rs17852045Ensembl.1
Natural variantiVAR_03958079T → M May be associated with type 2 diabetes obese individuals. 1 PublicationCorresponds to variant dbSNP:rs1130435Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0380391M → MKTVTMMMVVEMQALTQVLR AVLSACTWVSRKGDLQRMKQ THKGKPPSSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U19869 mRNA Translation: AAB82751.1
X90908 mRNA Translation: CAA62415.1
DQ132786 mRNA Translation: ABA12611.1
AC008609 Genomic DNA No translation available.
AC112191 Genomic DNA No translation available.
BC022489 mRNA Translation: AAH22489.1 Different initiation.
AJ250902 Genomic DNA Translation: CAB65728.1
CCDSiCCDS43393.1 [P51161-2]
CCDS4349.1 [P51161-1]
PIRiS63983
RefSeqiNP_001035532.1, NM_001040442.1 [P51161-2]
NP_001124430.1, NM_001130958.1 [P51161-2]
NP_001436.1, NM_001445.2 [P51161-1]
UniGeneiHs.519719

Genome annotation databases

EnsembliENST00000393980; ENSP00000377549; ENSG00000170231 [P51161-2]
ENST00000402432; ENSP00000385433; ENSG00000170231 [P51161-1]
GeneIDi2172
KEGGihsa:2172
UCSCiuc003lxx.2 human [P51161-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U19869 mRNA Translation: AAB82751.1
X90908 mRNA Translation: CAA62415.1
DQ132786 mRNA Translation: ABA12611.1
AC008609 Genomic DNA No translation available.
AC112191 Genomic DNA No translation available.
BC022489 mRNA Translation: AAH22489.1 Different initiation.
AJ250902 Genomic DNA Translation: CAB65728.1
CCDSiCCDS43393.1 [P51161-2]
CCDS4349.1 [P51161-1]
PIRiS63983
RefSeqiNP_001035532.1, NM_001040442.1 [P51161-2]
NP_001124430.1, NM_001130958.1 [P51161-2]
NP_001436.1, NM_001445.2 [P51161-1]
UniGeneiHs.519719

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1O1UNMR-A2-128[»]
1O1VNMR-A2-128[»]
2MM3NMR-A2-128[»]
5L8IX-ray1.88A/B/C1-128[»]
5L8NX-ray2.12A/B/C1-128[»]
5L8OX-ray2.39A/B/C1-128[»]
ProteinModelPortaliP51161
SMRiP51161
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000377549

Chemistry databases

DrugBankiDB02659 Cholic Acid
DB02691 N-Cholylglycine
DB04348 Taurocholic Acid
SwissLipidsiSLP:000001518

PTM databases

iPTMnetiP51161
PhosphoSitePlusiP51161

Polymorphism and mutation databases

BioMutaiFABP6
DMDMi1708457

Proteomic databases

EPDiP51161
MaxQBiP51161
PaxDbiP51161
PeptideAtlasiP51161
PRIDEiP51161
ProteomicsDBi56292
56293 [P51161-2]

Protocols and materials databases

DNASUi2172
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393980; ENSP00000377549; ENSG00000170231 [P51161-2]
ENST00000402432; ENSP00000385433; ENSG00000170231 [P51161-1]
GeneIDi2172
KEGGihsa:2172
UCSCiuc003lxx.2 human [P51161-1]

Organism-specific databases

CTDi2172
DisGeNETi2172
EuPathDBiHostDB:ENSG00000170231.15
GeneCardsiFABP6
HGNCiHGNC:3561 FABP6
HPAiCAB024713
HPA012601
MIMi600422 gene
neXtProtiNX_P51161
OpenTargetsiENSG00000170231
PharmGKBiPA27962
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4015 Eukaryota
ENOG4111US8 LUCA
GeneTreeiENSGT00390000012034
HOGENOMiHOG000004830
HOVERGENiHBG005633
InParanoidiP51161
KOiK08755
OMAiCDMETIG
OrthoDBiEOG091G16BV
PhylomeDBiP51161
TreeFamiTF330348

Enzyme and pathway databases

ReactomeiR-HSA-159418 Recycling of bile acids and salts
R-HSA-163560 Triglyceride catabolism

Miscellaneous databases

ChiTaRSiFABP6 human
EvolutionaryTraceiP51161
GeneWikiiFABP6
GenomeRNAii2172
PROiPR:P51161
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170231 Expressed in 131 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_FABP6
ExpressionAtlasiP51161 baseline and differential
GenevisibleiP51161 HS

Family and domain databases

Gene3Di2.40.128.20, 1 hit
InterProiView protein in InterPro
IPR012674 Calycin
IPR000463 Fatty_acid-bd
IPR031257 Gastrotropin
IPR031259 ILBP
PANTHERiPTHR11955 PTHR11955, 1 hit
PTHR11955:SF69 PTHR11955:SF69, 1 hit
PRINTSiPR00178 FATTYACIDBP
SUPFAMiSSF50814 SSF50814, 1 hit
PROSITEiView protein in PROSITE
PS00214 FABP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFABP6_HUMAN
AccessioniPrimary (citable) accession number: P51161
Secondary accession number(s): Q07DR7, Q8TBI3, Q9UGI7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 167 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again