UniProtKB - P50895 (BCAM_HUMAN)

BLAST

>sp|P50895|BCAM_HUMAN Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHD
HYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDE
RDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPA
PKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAH
YSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPE
YTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAY
LDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNG
TYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPD
PKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTV
SPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGS
EQPEQTGLLMGGASGGARGGSGGFGDEC

Align
Format
Add to basket Added to basket
History
Entry version 178 (07 Nov 2018)
Sequence version 2 (07 Mar 2006)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Basal cell adhesion molecule

Gene

BCAM

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Laminin alpha-5 receptor. May mediate intracellular signaling.1 Publication

GO - Molecular functionⁱ

laminin binding
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 16236823
laminin receptor activity
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 16236823
protein C-terminus binding
Source: CACAO
Inferred from direct assayⁱ
- 24453976
transmembrane signaling receptor activity
Source: ProtInc
Traceable author statementⁱ
- 7777537

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell adhesion
Source: ProtInc
Traceable author statementⁱ
- 7954395
cell-matrix adhesion
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 16236823
signal transduction
Source: ProtInc
Traceable author statementⁱ
- 7777537

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Blood group antigen, Receptor
Biological process	Cell adhesion

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Basal cell adhesion molecule Alternative name(s): Auberger B antigen B-CAM cell surface glycoprotein F8/G253 antigen Lutheran antigen Lutheran blood group glycoprotein CD_antigen: CD239
Gene namesⁱ	Name:BCAM Synonyms:LU, MSK19
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 19

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000187244.10
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:6722 BCAM
MIMⁱ	612773 gene
neXtProtⁱ	NX_P50895

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	32 – 547	ExtracellularSequence analysisAdd BLAST	516
Transmembraneⁱ	548 – 568	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	569 – 628	CytoplasmicSequence analysisAdd BLAST	60

Keywords - Cellular componentⁱ

Membrane

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	621	S → A: Dramatically reduced cell adhesion. 1 Publication		1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	4059
MalaCards human disease database More...MalaCardsⁱ	BCAM
MIMⁱ	111200 phenotype 247420 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000187244
PharmGKBⁱ	PA30484

Polymorphism and mutation databases

BioMutaⁱ	BCAM
DMDMⁱ	92058724

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 31	1 PublicationAdd BLAST		31
ChainⁱPRO_0000014850	32 – 628	Basal cell adhesion moleculeAdd BLAST		597

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	53 ↔ 125	PROSITE-ProRule annotation1 Publication
Disulfide bondⁱ	172 ↔ 237	PROSITE-ProRule annotation1 Publication
Disulfide bondⁱ	291 ↔ 337	1 Publication
Glycosylationⁱ	321	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	377	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	383	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	384 ↔ 424	1 Publication
Glycosylationⁱ	419	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	439	N-linked (GlcNAc...) asparagine2 Publications	1
Disulfide bondⁱ	473 ↔ 522	1 Publication
Modified residueⁱ	596	Phosphoserine; by GSK31 Publication	1
Modified residueⁱ	598	Phosphoserine; by CK21 Publication	1
Modified residueⁱ	600	PhosphoserineCombined sources	1
Modified residueⁱ	621	Phosphoserine; by PKA1 Publication	1

Post-translational modificationⁱ

Epinephrine-stimulated phosphorylation of Ser-621 by PKA enhances adhesion to laminin.1 Publication

Keywords - PTMⁱ

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDⁱ	P50895
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P50895
PaxDbⁱ	P50895
PeptideAtlas More...PeptideAtlasⁱ	P50895
PRIDEⁱ	P50895
ProteomicsDBⁱ	56268

PTM databases

GlyConnectⁱ	1026
iPTMnetⁱ	P50895
PhosphoSitePlusⁱ	P50895
SwissPalmⁱ	P50895

Expressionⁱ

Tissue specificityⁱ

Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.

Developmental stageⁱ

Is under developmental control in liver and may also be regulated during differentiation in other tissues. Up-regulated following malignant transformation in some cell types.

Gene expression databases

Bgeeⁱ	ENSG00000187244 Expressed in 198 organ(s), highest expression level in adult mammalian kidney
CleanExⁱ	HS_BCAM
ExpressionAtlasⁱ	P50895 baseline and differential
Genevisibleⁱ	P50895 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA005654

HPAⁱ

HPA005654

Interactionⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
KLHL2	O95198	6	EBI-10212133,EBI-746999

With

Entry

#Exp.

IntAct

Notes

KLHL2

O95198

EBI-10212133,EBI-746999

GO - Molecular functionⁱ

laminin binding
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 16236823
protein C-terminus binding
Source: CACAO
Inferred from direct assayⁱ
- 24453976

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	110237, 23 interactors
ELMⁱ	P50895
IntActⁱ	P50895, 8 interactors
STRINGⁱ	9606.ENSP00000270233

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	34 – 36	Combined sources	3
Beta strandⁱ	39 – 44	Combined sources	6
Beta strandⁱ	49 – 51	Combined sources	3
Beta strandⁱ	54 – 57	Combined sources	4
Beta strandⁱ	60 – 69	Combined sources	10
Beta strandⁱ	77 – 84	Combined sources	8
Beta strandⁱ	87 – 92	Combined sources	6
Beta strandⁱ	110 – 114	Combined sources	5
Helixⁱ	117 – 119	Combined sources	3
Beta strandⁱ	121 – 128	Combined sources	8
Helixⁱ	130 – 132	Combined sources	3
Beta strandⁱ	134 – 145	Combined sources	12
Beta strandⁱ	151 – 154	Combined sources	4
Beta strandⁱ	167 – 179	Combined sources	13
Beta strandⁱ	182 – 187	Combined sources	6
Beta strandⁱ	190 – 192	Combined sources	3
Beta strandⁱ	200 – 210	Combined sources	11
Beta strandⁱ	216 – 224	Combined sources	9
Helixⁱ	228 – 232	Combined sources	5
Beta strandⁱ	234 – 242	Combined sources	9
Helixⁱ	244 – 246	Combined sources	3
Beta strandⁱ	248 – 252	Combined sources	5

Show more details

3D structure databases

ProteinModelPortalⁱ	P50895
SMRⁱ	P50895
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P50895

EvolutionaryTraceⁱ

P50895

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Domainⁱ	32 – 142	Ig-like V-type 1Add BLAST	111
Domainⁱ	147 – 257	Ig-like V-type 2Add BLAST	111
Domainⁱ	274 – 355	Ig-like C2-type 1Add BLAST	82
Domainⁱ	363 – 441	Ig-like C2-type 2Add BLAST	79
Domainⁱ	448 – 541	Ig-like C2-type 3Add BLAST	94

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	309 – 312	Interaction with laminin alpha5		4

Keywords - Domainⁱ

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410IJIS Eukaryota ENOG4111XZT LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000063457
HOGENOMⁱ	HOG000113409
InParanoidⁱ	P50895
KEGG Orthology (KO) More...KOⁱ	K06578
OMAⁱ	DHFVLEW
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G05IA
PhylomeDBⁱ	P50895
TreeFamⁱ	TF330534

Family and domain databases

Gene3Dⁱ	2.60.40.10, 5 hits
InterProⁱ	View protein in InterPro IPR013162 CD80_C2-set IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003599 Ig_sub IPR003598 Ig_sub2 IPR013106 Ig_V-set
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF08205 C2-set_2, 1 hit PF13895 Ig_2, 2 hits PF07686 V-set, 1 hit
SMARTⁱ	View protein in SMART SM00409 IG, 5 hits SM00408 IGc2, 3 hits
SUPFAMⁱ	SSF48726 SSF48726, 5 hits
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 5 hits

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

P50895-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MEPPDAPAQA RGAPRLLLLA VLLAAHPDAQ AEVRLSVPPL VEVMRGKSVI 
        60         70         80         90        100
LDCTPTGTHD HYMLEWFLTD RSGARPRLAS AEMQGSELQV TMHDTRGRSP 
       110        120        130        140        150
PYQLDSQGRL VLAEAQVGDE RDYVCVVRAG AAGTAEATAR LNVFAKPEAT 
       160        170        180        190        200
EVSPNKGTLS VMEDSAQEIA TCNSRNGNPA PKITWYRNGQ RLEVPVEMNP 
       210        220        230        240        250
EGYMTSRTVR EASGLLSLTS TLYLRLRKDD RDASFHCAAH YSLPEGRHGR 
       260        270        280        290        300
LDSPTFHLTL HYPTEHVQFW VGSPSTPAGW VREGDTVQLL CRGDGSPSPE 
       310        320        330        340        350
YTLFRLQDEQ EEVLNVNLEG NLTLEGVTRG QSGTYGCRVE DYDAADDVQL 
       360        370        380        390        400
SKTLELRVAY LDPLELSEGK VLSLPLNSSA VVNCSVHGLP TPALRWTKDS 
       410        420        430        440        450
TPLGDGPMLS LSSITFDSNG TYVCEASLPT VPVLSRTQNF TLLVQGSPEL 
       460        470        480        490        500
KTAEIEPKAD GSWREGDEVT LICSARGHPD PKLSWSQLGG SPAEPIPGRQ 
       510        520        530        540        550
GWVSSSLTLK VTSALSRDGI SCEASNPHGN KRHVFHFGTV SPQTSQAGVA 
       560        570        580        590        600
VMAVAVSVGL LLLVVAVFYC VRRKGGPCCR QRREKGAPPP GEPGLSHSGS 
       610        620 
EQPEQTGLLM GGASGGARGG SGGFGDEC

Length:628

Mass (Da):67,405

Last modified:March 7, 2006 - v2

Checksum:ⁱC88F4F5C640C3F5B

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

K7ENU8	K7ENU8_HUMAN	Basal cell adhesion molecule Basal cell adhesion molecule	BCAM	286	Annotation score:
A0A087WXM8	A0A087WXM8_HUMAN	Basal cell adhesion molecule Basal cell adhesion molecule	BCAM	588	Annotation score:
K7ERB7	K7ERB7_HUMAN	Basal cell adhesion molecule Basal cell adhesion molecule	BCAM	61	Annotation score:

Sequence cautionⁱ

The sequence EAW57297 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	225 – 226	RL → PC in CAA56327 (PubMed:7954395).Curated	2
Sequence conflictⁱ	355 – 356	EL → DV in CAA56327 (PubMed:7954395).Curated	2
Sequence conflictⁱ	532	R → L in ABY27636 (Ref. 7) Curated	1

Polymorphismⁱ

BCAM is responsible for the Lutheran blood group system (LU) [MIMⁱ:111200]. Lutheran is a complex blood group system consisting of 19 antigens. Antigens Lu(a) and Lu(b) are defined by a polymorphism at position 77: Lu(a) has His-77 and Lu(b) has Arg-77.2 Publications

Inactivating variants in BCAM are responsible for the recessive Lutheran null phenotype Lu(a-b-) of the Lutheran blood group [MIMⁱ:247420]. Autosomal recessive inheritance of the Lutheran null blood group phenotype is extremely rare. There is no obvious associated clinical or hematologic pathology, and all patients have been identified through identification of anti-Lu3 antibodies in their serum.1 Publication

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_021348	77	R → H Defines the Lu(a) antigen. 1 PublicationCorresponds to variant dbSNP:rs28399653EnsemblClinVar.	1
Natural variantⁱVAR_021349	196	V → I1 PublicationCorresponds to variant dbSNP:rs28399654Ensembl.	1
Natural variantⁱVAR_021350	204	M → K1 PublicationCorresponds to variant dbSNP:rs28399656Ensembl.	1
Natural variantⁱVAR_021351	282	R → H1 PublicationCorresponds to variant dbSNP:rs9967601Ensembl.	1
Natural variantⁱVAR_021352	381	V → I1 PublicationCorresponds to variant dbSNP:rs28399626Ensembl.	1
Natural variantⁱVAR_021353	451	K → Q1 PublicationCorresponds to variant dbSNP:rs28399630Ensembl.	1
Natural variantⁱVAR_021354	539	T → A3 PublicationsCorresponds to variant dbSNP:rs1135062EnsemblClinVar.	1
Natural variantⁱVAR_021355	581	Q → L1 PublicationCorresponds to variant dbSNP:rs28399659Ensembl.	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X83425 mRNA Translation: CAA58449.1 AY845133 Genomic DNA Translation: AAV88096.1 AC092306 Genomic DNA No translation available. CH471126 Genomic DNA Translation: EAW57297.1 Sequence problems. BC050450 mRNA Translation: AAH50450.1 X80026 mRNA Translation: CAA56327.1 EU307108 Genomic DNA Translation: ABY27636.1 EU307109 Genomic DNA Translation: ABY27637.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS12644.1
PIRⁱ	I37202 I38000
NCBI Reference Sequences More...RefSeqⁱ	NP_001013275.1, NM_001013257.2 NP_005572.2, NM_005581.4
UniGeneⁱ	Hs.625725

Genome annotation databases

Ensemblⁱ	ENST00000270233; ENSP00000270233; ENSG00000187244
GeneIDⁱ	4059
KEGGⁱ	hsa:4059
UCSC genome browser More...UCSCⁱ	uc002ozu.5 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P50895	Basal cell adhesion molecule		HUMAN		588	UniRef100_P50895
UPI0001753DFB		HUMAN		231

Protein	Similar proteins		Species	Score	Length	Source
P50895	Basal cell adhesion molecule		HUMAN		588	UniRef90_P50895
Uncharacterized protein		PAPAN		659
Uncharacterized protein		MACNE		659
Uncharacterized protein (Fragment)		MACMU		561
Uncharacterized protein		CERAT		659
+44

Protein	Similar proteins		Species	Score	Length	Source
P50895	Basal cell adhesion molecule		HUMAN		588	UniRef50_P50895
Uncharacterized protein		MACNE		659
Uncharacterized protein (Fragment)		MACMU		561
Uncharacterized protein		CERAT		659
Uncharacterized protein		PAPAN		659
+59

Cross-referencesⁱ

Web resourcesⁱ

dbRBC/BGMUT

Blood group antigen gene mutation database

SeattleSNPs

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X83425 mRNA Translation: CAA58449.1 AY845133 Genomic DNA Translation: AAV88096.1 AC092306 Genomic DNA No translation available. CH471126 Genomic DNA Translation: EAW57297.1 Sequence problems. BC050450 mRNA Translation: AAH50450.1 X80026 mRNA Translation: CAA56327.1 EU307108 Genomic DNA Translation: ABY27636.1 EU307109 Genomic DNA Translation: ABY27637.1
CCDSⁱ	CCDS12644.1
PIRⁱ	I37202 I38000
RefSeqⁱ	NP_001013275.1, NM_001013257.2 NP_005572.2, NM_005581.4
UniGeneⁱ	Hs.625725

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2PET	X-ray	1.70	A	32-262	[»]
	2PF6	X-ray	2.20	A/B	32-262	[»]
ProteinModelPortalⁱ	P50895
SMRⁱ	P50895
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	110237, 23 interactors
ELMⁱ	P50895
IntActⁱ	P50895, 8 interactors
STRINGⁱ	9606.ENSP00000270233

PTM databases

GlyConnectⁱ	1026
iPTMnetⁱ	P50895
PhosphoSitePlusⁱ	P50895
SwissPalmⁱ	P50895

Polymorphism and mutation databases

BioMutaⁱ	BCAM
DMDMⁱ	92058724

Proteomic databases

EPDⁱ	P50895
MaxQBⁱ	P50895
PaxDbⁱ	P50895
PeptideAtlasⁱ	P50895
PRIDEⁱ	P50895
ProteomicsDBⁱ	56268

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000270233; ENSP00000270233; ENSG00000187244
GeneIDⁱ	4059
KEGGⁱ	hsa:4059
UCSCⁱ	uc002ozu.5 human

Organism-specific databases

CTDⁱ	4059
DisGeNETⁱ	4059
EuPathDBⁱ	HostDB:ENSG00000187244.10
GeneCardsⁱ	BCAM
HGNCⁱ	HGNC:6722 BCAM
HPAⁱ	HPA005654
MalaCardsⁱ	BCAM
MIMⁱ	111200 phenotype 247420 phenotype 612773 gene
neXtProtⁱ	NX_P50895
OpenTargetsⁱ	ENSG00000187244
PharmGKBⁱ	PA30484
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IJIS Eukaryota ENOG4111XZT LUCA
GeneTreeⁱ	ENSGT00530000063457
HOGENOMⁱ	HOG000113409
InParanoidⁱ	P50895
KOⁱ	K06578
OMAⁱ	DHFVLEW
OrthoDBⁱ	EOG091G05IA
PhylomeDBⁱ	P50895
TreeFamⁱ	TF330534

Miscellaneous databases

ChiTaRSⁱ	BCAM human
EvolutionaryTraceⁱ	P50895
GeneWikiⁱ	BCAM
GenomeRNAiⁱ	4059
Protein Ontology More...PROⁱ	PR:P50895
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000187244 Expressed in 198 organ(s), highest expression level in adult mammalian kidney
CleanExⁱ	HS_BCAM
ExpressionAtlasⁱ	P50895 baseline and differential
Genevisibleⁱ	P50895 HS

Family and domain databases

Gene3Dⁱ	2.60.40.10, 5 hits
InterProⁱ	View protein in InterPro IPR013162 CD80_C2-set IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003599 Ig_sub IPR003598 Ig_sub2 IPR013106 Ig_V-set
Pfamⁱ	View protein in Pfam PF08205 C2-set_2, 1 hit PF13895 Ig_2, 2 hits PF07686 V-set, 1 hit
SMARTⁱ	View protein in SMART SM00409 IG, 5 hits SM00408 IGc2, 3 hits
SUPFAMⁱ	SSF48726 SSF48726, 5 hits
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 5 hits
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	BCAM_HUMAN
Accessionⁱ	P50895Primary (citable) accession number: P50895 Secondary accession number(s): A8MYF9 , A9YWT5, A9YWT6, Q86VC7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	October 1, 1996
	Last sequence update:	March 7, 2006
	Last modified:	November 7, 2018
	This is version 178 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 19
Human chromosome 19: entries, gene names and cross-references to MIM
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Blood group antigen proteins
Nomenclature of blood group antigens and list of entries
Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P50895 (BCAM_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Basal cell adhesion molecule

BCAM

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Extracellular region or secreted

Plasma Membrane

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ