Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P49903 (SPS1_HUMAN)

Entry version 179 (02 Dec 2020)
Sequence version 2 (13 Dec 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Selenide, water dikinase 1

Gene

SEPHS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Synthesizes selenophosphate from selenide and ATP.1 Publication

Caution

The conserved active site Cys (or selenocysteine) residue in position 29 is replaced by a Thr. However, as function in selenoprotein synthesis is proven, it is possible Cys-31 is the active site.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 PublicationNote: Binds 1 Mg2+ ion per monomer.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by phosphate ions and by potassium ions.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei31Sequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei32ATPCombined sources1 Publication1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei32Important for catalytic activityBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi69MagnesiumCombined sources1 Publication1
Binding sitei87ATPCombined sources1 Publication1
Metal bindingi110MagnesiumCombined sources1 Publication1
Binding sitei110ATPCombined sources1 Publication1
Metal bindingi265MagnesiumCombined sources1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi67 – 69ATPCombined sources1 Publication3
Nucleotide bindingi161 – 164ATP; shared with dimeric partnerCombined sources1 Publication4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Selenium

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.9.3, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P49903

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Selenide, water dikinase 1 (EC:2.7.9.31 Publication)
Alternative name(s):
Selenium donor protein 1
Selenophosphate synthase 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEPHS1
Synonyms:SELD, SPS, SPS1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000086475.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:19685, SEPHS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600902, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P49903

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi85T → A: Strongly reduced ADP hydrolysis. 1 Publication1
Mutagenesisi268G → C: No change in ATP-binding. 1 Publication1
Mutagenesisi270G → R: No change in ATP-binding. 1 Publication1
Mutagenesisi273G → A, D or V: Loss of ATP-binding. 1 Publication1
Mutagenesisi274H → N: Reduced ATP-binding. 1 Publication1
Mutagenesisi274H → Y: Increased ATP-binding. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		22929

Open Targets

More...OpenTargetsi		ENSG00000086475

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134905215

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P49903, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SEPHS1

Domain mapping of disease mutations (DMDM)

More...DMDMi		27151792

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001276482 – 392Selenide, water dikinase 1Add BLAST391

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P49903

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P49903

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P49903

MaxQB - The MaxQuant DataBase

More...MaxQBi		P49903

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P49903

PeptideAtlas

More...PeptideAtlasi		P49903

PRoteomics IDEntifications database

More...PRIDEi		P49903

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		12836
5348
56175 [P49903-1]
64555

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P49903

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P49903

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P49903

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P49903

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Gradually expressed during the cell cycle until G2/M phase and then decreases.1 Publication
Gradually expressed during the cell cycle until G2/M phase and then decreases.1 Publication
Gradually expressed during the cell cycle until S phase and then decreases.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000086475, Expressed in female gonad and 231 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P49903, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P49903, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000086475, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:20471958, PubMed:19477186). Heterodimer with isoform 3 (PubMed:20471958).

2 Publications

Homodimer (PubMed:20471958). Heterodimer with isoform 4 (PubMed:20471958).

1 Publication

Homodimer (PubMed:20471958). Heterodimer with isoform 1 (PubMed:20471958).

1 Publication

Homodimer (PubMed:20471958). Heterodimer with isoform 2 (PubMed:20471958).

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116589, 58 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P49903

Protein interaction database and analysis system

More...IntActi		P49903, 22 interactors

Molecular INTeraction database

More...MINTi		P49903

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000367893

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P49903, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1392
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P49903

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P49903

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the selenophosphate synthase 1 family. Class II subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3939, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000000950

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_032859_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P49903

Identification of Orthologs from Complete Genome Data

More...OMAi		MNIVCFP

Database of Orthologous Groups

More...OrthoDBi		1166567at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P49903

TreeFam database of animal gene trees

More...TreeFami		TF313811

Family and domain databases

Conserved Domains Database

More...CDDi		cd02195, SelD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1330.10, 1 hit
3.90.650.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR010918, PurM-like_C_dom
IPR036676, PurM-like_C_sf
IPR016188, PurM-like_N
IPR036921, PurM-like_N_sf
IPR004536, SPS/SelD

The PANTHER Classification System

More...PANTHERi		PTHR10256, PTHR10256, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00586, AIRS, 1 hit
PF02769, AIRS_C, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF036407, Selenphspht_syn, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF55326, SSF55326, 1 hit
SSF56042, SSF56042, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00476, selD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P49903-1) [UniParc]FASTAAdd to basket
Also known as: Major type, MT

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTRESFNPE SYELDKSFRL TRFTELKGTG CKVPQDVLQK LLESLQENHF 
        60         70         80         90        100
QEDEQFLGAV MPRLGIGMDT CVIPLRHGGL SLVQTTDYIY PIVDDPYMMG 
       110        120        130        140        150
RIACANVLSD LYAMGVTECD NMLMLLGVSN KMTDRERDKV MPLIIQGFKD 
       160        170        180        190        200
AAEEAGTSVT GGQTVLNPWI VLGGVATTVC QPNEFIMPDN AVPGDVLVLT 
       210        220        230        240        250
KPLGTQVAVA VHQWLDIPEK WNKIKLVVTQ EDVELAYQEA MMNMARLNRT 
       260        270        280        290        300
AAGLMHTFNA HAATDITGFG ILGHAQNLAK QQRNEVSFVI HNLPVLAKMA 
       310        320        330        340        350
AVSKACGNMF GLMHGTCPET SGGLLICLPR EQAARFCAEI KSPKYGEGHQ 
       360        370        380        390 
AWIIGIVEKG NRTARIIDKP RIIEVAPQVA TQNVNPTPGA TS
Length:392
Mass (Da):42,911
Last modified:December 13, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE9636E38146D926D
GO
Isoform 2 (identifier: P49903-2) [UniParc]FASTAAdd to basket
Also known as: Delta E8

The sequence of this isoform differs from the canonical sequence as follows:
     251-321: Missing.

Show »
Length:321
Mass (Da):35,479
Checksum:i1894C5DBC991ABA8
GO
Isoform 3 (identifier: P49903-3) [UniParc]FASTAAdd to basket
Also known as: Delta E2

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Show »
Length:325
Mass (Da):35,208
Checksum:i6938A3EB8339E631
GO
Isoform 4 (identifier: P49903-4) [UniParc]FASTAAdd to basket
Also known as: E9, E9a

The sequence of this isoform differs from the canonical sequence as follows:
     322-392: GGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS → DVQ

Show »
Length:324
Mass (Da):35,620
Checksum:i538F17DE5C1D3644
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T5U6Q5T5U6_HUMAN
Selenide, water dikinase 1
SEPHS1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T5U7Q5T5U7_HUMAN
Selenide, water dikinase 1
SEPHS1
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA87567 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti260A → T in AAA87567 (PubMed:7665581).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0467011 – 67Missing in isoform 3. 2 PublicationsAdd BLAST67
Alternative sequenceiVSP_046702251 – 321Missing in isoform 2. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_047451322 – 392GGLLI…PGATS → DVQ in isoform 4. 1 PublicationAdd BLAST71

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U34044 mRNA Translation: AAA87567.1 Frameshift.
GU954545 mRNA Translation: ADF78120.1
GU954546 mRNA Translation: ADF78121.1
GU954547 mRNA Translation: ADF78122.1
GU954548 mRNA Translation: ADF78123.1
GU954549 mRNA Translation: ADF78124.1
AK301568 mRNA Translation: BAG63062.1
AL138764 Genomic DNA No translation available.
AL355870 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86289.1
CH471072 Genomic DNA Translation: EAW86290.1
CH471072 Genomic DNA Translation: EAW86291.1
CH471072 Genomic DNA Translation: EAW86292.1
CH471072 Genomic DNA Translation: EAW86293.1
BC000941 mRNA Translation: AAH00941.1
BC063816 mRNA Translation: AAH63816.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55702.1 [P49903-3]
CCDS55703.1 [P49903-2]
CCDS7098.1 [P49903-1]

NCBI Reference Sequences

More...RefSeqi		NP_001182531.1, NM_001195602.1 [P49903-3]
NP_001182533.1, NM_001195604.1 [P49903-2]
NP_036379.2, NM_012247.4 [P49903-1]
XP_016871431.1, XM_017015942.1
XP_016871432.1, XM_017015943.1 [P49903-1]
XP_016871434.1, XM_017015945.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000327347; ENSP00000367893; ENSG00000086475 [P49903-1]
ENST00000378614; ENSP00000367877; ENSG00000086475 [P49903-2]
ENST00000545675; ENSP00000441119; ENSG00000086475 [P49903-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		22929

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:22929

UCSC genome browser

More...UCSCi		uc001imk.4, human [P49903-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U34044 mRNA Translation: AAA87567.1 Frameshift.
GU954545 mRNA Translation: ADF78120.1
GU954546 mRNA Translation: ADF78121.1
GU954547 mRNA Translation: ADF78122.1
GU954548 mRNA Translation: ADF78123.1
GU954549 mRNA Translation: ADF78124.1
AK301568 mRNA Translation: BAG63062.1
AL138764 Genomic DNA No translation available.
AL355870 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86289.1
CH471072 Genomic DNA Translation: EAW86290.1
CH471072 Genomic DNA Translation: EAW86291.1
CH471072 Genomic DNA Translation: EAW86292.1
CH471072 Genomic DNA Translation: EAW86293.1
BC000941 mRNA Translation: AAH00941.1
BC063816 mRNA Translation: AAH63816.1
CCDSiCCDS55702.1 [P49903-3]
CCDS55703.1 [P49903-2]
CCDS7098.1 [P49903-1]
RefSeqiNP_001182531.1, NM_001195602.1 [P49903-3]
NP_001182533.1, NM_001195604.1 [P49903-2]
NP_036379.2, NM_012247.4 [P49903-1]
XP_016871431.1, XM_017015942.1
XP_016871432.1, XM_017015943.1 [P49903-1]
XP_016871434.1, XM_017015945.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FD5X-ray1.90A/B1-392[»]
3FD6X-ray1.95A/B1-392[»]
SMRiP49903
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116589, 58 interactors
CORUMiP49903
IntActiP49903, 22 interactors
MINTiP49903
STRINGi9606.ENSP00000367893

PTM databases

iPTMnetiP49903
MetOSiteiP49903
PhosphoSitePlusiP49903
SwissPalmiP49903

Polymorphism and mutation databases

BioMutaiSEPHS1
DMDMi27151792

Proteomic databases

EPDiP49903
jPOSTiP49903
MassIVEiP49903
MaxQBiP49903
PaxDbiP49903
PeptideAtlasiP49903
PRIDEiP49903
ProteomicsDBi12836
5348
56175 [P49903-1]
64555

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		24810, 184 antibodies

The DNASU plasmid repository

More...DNASUi		22929

Genome annotation databases

EnsembliENST00000327347; ENSP00000367893; ENSG00000086475 [P49903-1]
ENST00000378614; ENSP00000367877; ENSG00000086475 [P49903-2]
ENST00000545675; ENSP00000441119; ENSG00000086475 [P49903-3]
GeneIDi22929
KEGGihsa:22929
UCSCiuc001imk.4, human [P49903-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		22929
DisGeNETi22929
EuPathDBiHostDB:ENSG00000086475.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		SEPHS1
HGNCiHGNC:19685, SEPHS1
HPAiENSG00000086475, Low tissue specificity
MIMi600902, gene
neXtProtiNX_P49903
OpenTargetsiENSG00000086475
PharmGKBiPA134905215

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3939, Eukaryota
GeneTreeiENSGT00390000000950
HOGENOMiCLU_032859_1_0_1
InParanoidiP49903
OMAiMNIVCFP
OrthoDBi1166567at2759
PhylomeDBiP49903
TreeFamiTF313811

Enzyme and pathway databases

BRENDAi2.7.9.3, 2681
PathwayCommonsiP49903

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		22929, 117 hits in 844 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SEPHS1, human
EvolutionaryTraceiP49903

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Selenophosphate_synthetase_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		22929
PharosiP49903, Tbio

Protein Ontology

More...PROi		PR:P49903
RNActiP49903, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000086475, Expressed in female gonad and 231 other tissues
ExpressionAtlasiP49903, baseline and differential
GenevisibleiP49903, HS

Family and domain databases

CDDicd02195, SelD, 1 hit
Gene3Di3.30.1330.10, 1 hit
3.90.650.10, 1 hit
InterProiView protein in InterPro
IPR010918, PurM-like_C_dom
IPR036676, PurM-like_C_sf
IPR016188, PurM-like_N
IPR036921, PurM-like_N_sf
IPR004536, SPS/SelD
PANTHERiPTHR10256, PTHR10256, 1 hit
PfamiView protein in Pfam
PF00586, AIRS, 1 hit
PF02769, AIRS_C, 1 hit
PIRSFiPIRSF036407, Selenphspht_syn, 1 hit
SUPFAMiSSF55326, SSF55326, 1 hit
SSF56042, SSF56042, 1 hit
TIGRFAMsiTIGR00476, selD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPS1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49903
Secondary accession number(s): B4DWK0
, D3DRS9, D6PSQ9, Q5T5U8, Q5T5U9, Q9BVT4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: December 13, 2002
Last modified: December 2, 2020
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again