Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic purine 5'-nucleotidase

Gene

NT5C2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May have a critical role in the maintenance of a constant composition of intracellular purine/pyrimidine nucleotides in cooperation with other nucleotidases. Preferentially hydrolyzes inosine 5'-monophosphate (IMP) and other purine nucleotides.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+Note: Binds 1 Mg2+ ion per subunit.

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Allosterically activated by various compounds, including ATP.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei52Nucleophile1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi52Magnesium1
Active sitei54Proton donor1
Metal bindingi54Magnesium; via carbonyl oxygen1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei127Allosteric activator 11
Binding sitei154Allosteric activator 21
Metal bindingi351Magnesium1
Binding sitei354Allosteric activator 21
Binding sitei436Allosteric activator 1; via carbonyl oxygen1
Binding sitei453Allosteric activator 21

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • adenosine metabolic process Source: GO_Central
  • drug metabolic process Source: Reactome
  • IMP metabolic process Source: GO_Central
  • purine nucleotide catabolic process Source: Reactome

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAllosteric enzyme, Hydrolase
Biological processNucleotide metabolism
LigandMagnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS01216-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.5 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2161541 Abacavir metabolism
R-HSA-74259 Purine catabolism

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
P49902

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytosolic purine 5'-nucleotidase (EC:3.1.3.5)
Alternative name(s):
Cytosolic 5'-nucleotidase II
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NT5C2
Synonyms:NT5B, NT5CP, PNT5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000076685.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8022 NT5C2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600417 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49902

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Spastic paraplegia 45, autosomal recessive (SPG45)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. Some SPG45 patients manifest mental retardation, contractures and learning disability.
See also OMIM:613162
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_079707460L → P in SPG45; unknown pathological significance. 1 Publication1

Keywords - Diseasei

Disease mutation, Hereditary spastic paraplegia, Neurodegeneration

Organism-specific databases

DisGeNET

More...
DisGeNETi
22978

MalaCards human disease database

More...
MalaCardsi
NT5C2
MIMi613162 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000076685

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
320396 Autosomal recessive spastic paraplegia type 45

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31801

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3708197

Drug and drug target database

More...
DrugBanki
DB00171 Adenosine triphosphate
DB00811 Ribavirin

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NT5C2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1703012

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000643891 – 561Cytosolic purine 5'-nucleotidaseAdd BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei418PhosphoserineCombined sources1
Modified residuei502PhosphoserineCombined sources1
Modified residuei511PhosphoserineCombined sources1
Modified residuei527PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P49902

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P49902

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49902

PeptideAtlas

More...
PeptideAtlasi
P49902

PRoteomics IDEntifications database

More...
PRIDEi
P49902

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56174

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P49902-1 [P49902-1]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
P49902

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49902

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49902

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000076685 Expressed in 233 organ(s), highest expression level in ectocervix

CleanEx database of gene expression profiles

More...
CleanExi
HS_NT5C2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49902 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49902 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003751

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116627, 35 interactors

Protein interaction database and analysis system

More...
IntActi
P49902, 14 interactors

Molecular INTeraction database

More...
MINTi
P49902

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000339479

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1561
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P49902

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49902

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P49902

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni202 – 210Substrate bindingSequence analysis9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi549 – 561Asp/Glu-rich (acidic)Add BLAST13

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2469 Eukaryota
ENOG410XQAV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162369

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000246075

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000025

KEGG Orthology (KO)

More...
KOi
K01081

Identification of Orthologs from Complete Genome Data

More...
OMAi
ACLYTSR

Database of Orthologous Groups

More...
OrthoDBi
EOG091G074N

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49902

TreeFam database of animal gene trees

More...
TreeFami
TF315266

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1000, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036412 HAD-like_sf
IPR008380 HAD-SF_hydro_IG_5-nucl
IPR023214 HAD_sf
IPR016695 Pur_nucleotidase

The PANTHER Classification System

More...
PANTHERi
PTHR12103 PTHR12103, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05761 5_nucleotid, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF017434 Purine_5'-nucleotidase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784 SSF56784, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02244 HAD-IG-Ncltidse, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P49902-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTSWSDRLQ NAADMPANMD KHALKKYRRE AYHRVFVNRS LAMEKIKCFG
60 70 80 90 100
FDMDYTLAVY KSPEYESLGF ELTVERLVSI GYPQELLSFA YDSTFPTRGL
110 120 130 140 150
VFDTLYGNLL KVDAYGNLLV CAHGFNFIRG PETREQYPNK FIQRDDTERF
160 170 180 190 200
YILNTLFNLP ETYLLACLVD FFTNCPRYTS CETGFKDGDL FMSYRSMFQD
210 220 230 240 250
VRDAVDWVHY KGSLKEKTVE NLEKYVVKDG KLPLLLSRMK EVGKVFLATN
260 270 280 290 300
SDYKYTDKIM TYLFDFPHGP KPGSSHRPWQ SYFDLILVDA RKPLFFGEGT
310 320 330 340 350
VLRQVDTKTG KLKIGTYTGP LQHGIVYSGG SSDTICDLLG AKGKDILYIG
360 370 380 390 400
DHIFGDILKS KKRQGWRTFL VIPELAQELH VWTDKSSLFE ELQSLDIFLA
410 420 430 440 450
ELYKHLDSSS NERPDISSIQ RRIKKVTHDM DMCYGMMGSL FRSGSRQTLF
460 470 480 490 500
ASQVMRYADL YAASFINLLY YPFSYLFRAA HVLMPHESTV EHTHVDINEM
510 520 530 540 550
ESPLATRNRT SVDFKDTDYK RHQLTRSISE IKPPNLFPLA PQEITHCHDE
560
DDDEEEEEEE E
Length:561
Mass (Da):64,970
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C27D762575E0EA2
GO
Isoform 2 (identifier: P49902-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSTSWSDRLQNAADMPANMDKHALKKYRREAYHR → MSKEG

Note: No experimental confirmation available.
Show »
Length:532
Mass (Da):61,441
Checksum:iE0DA487A03BC5F7E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JUV4Q5JUV4_HUMAN
Cytosolic purine 5'-nucleotidase
NT5C2
265Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3A6S4R3A6_HUMAN
Cytosolic purine 5'-nucleotidase
NT5C2
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JUV3Q5JUV3_HUMAN
Cytosolic purine 5'-nucleotidase
NT5C2
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JUV6Q5JUV6_HUMAN
Cytosolic purine 5'-nucleotidase
NT5C2
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHR8H0YHR8_HUMAN
Cytosolic purine 5'-nucleotidase
NT5C2
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3E7S4R3E7_HUMAN
Cytosolic purine 5'-nucleotidase
NT5C2
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0242443T → A1 PublicationCorresponds to variant dbSNP:rs10883841EnsemblClinVar.1
Natural variantiVAR_030242136Q → R. Corresponds to variant dbSNP:rs12262171EnsemblClinVar.1
Natural variantiVAR_079707460L → P in SPG45; unknown pathological significance. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0542351 – 34MSTSW…EAYHR → MSKEG in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D38524 mRNA Translation: BAA07529.1
AK295593 mRNA Translation: BAH12118.1
AL139817 Genomic DNA No translation available.
AL360001 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49656.1
CH471066 Genomic DNA Translation: EAW49657.1
BC001595 mRNA Translation: AAH01595.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7544.1 [P49902-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC2436

NCBI Reference Sequences

More...
RefSeqi
NP_001127845.1, NM_001134373.2 [P49902-1]
NP_036361.1, NM_012229.4 [P49902-1]
XP_005269693.1, XM_005269636.4
XP_005269696.1, XM_005269639.4

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.734531
Hs.97439

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343289; ENSP00000339479; ENSG00000076685 [P49902-1]
ENST00000404739; ENSP00000383960; ENSG00000076685 [P49902-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22978

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22978

UCSC genome browser

More...
UCSCi
uc001kwq.4 human [P49902-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D38524 mRNA Translation: BAA07529.1
AK295593 mRNA Translation: BAH12118.1
AL139817 Genomic DNA No translation available.
AL360001 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49656.1
CH471066 Genomic DNA Translation: EAW49657.1
BC001595 mRNA Translation: AAH01595.1
CCDSiCCDS7544.1 [P49902-1]
PIRiJC2436
RefSeqiNP_001127845.1, NM_001134373.2 [P49902-1]
NP_036361.1, NM_012229.4 [P49902-1]
XP_005269693.1, XM_005269636.4
XP_005269696.1, XM_005269639.4
UniGeneiHs.734531
Hs.97439

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2J2CX-ray2.20A1-536[»]
2JC9X-ray1.50A1-536[»]
2JCMX-ray2.15A1-536[»]
2XCVX-ray2.30A1-536[»]
2XCWX-ray1.90A1-536[»]
2XCXX-ray2.30A1-536[»]
2XJBX-ray2.30A1-536[»]
2XJCX-ray2.00A1-536[»]
2XJDX-ray2.00A1-536[»]
2XJEX-ray2.30A1-536[»]
2XJFX-ray2.10A1-536[»]
4H4BX-ray2.90A1-536[»]
5CQZX-ray2.90A/B1-536[»]
5CR7X-ray2.90A/B1-536[»]
5K7YX-ray1.79A1-536[»]
5L4ZX-ray1.84A1-536[»]
5L50X-ray1.64A1-536[»]
5OPKX-ray1.74A3-488[»]
5OPLX-ray1.80A1-536[»]
5OPMX-ray1.68A3-488[»]
5OPNX-ray1.77A3-488[»]
5OPOX-ray2.00A3-488[»]
5OPPX-ray1.70A3-488[»]
6DD3X-ray1.98A1-536[»]
6DDBX-ray2.80A/B1-536[»]
6DDCX-ray2.91A/B1-536[»]
6DDHX-ray2.35A1-536[»]
6DDKX-ray2.50A/B1-561[»]
6DDLX-ray2.26A/B1-523[»]
6DDOX-ray2.48A/B1-561[»]
6DDQX-ray2.31A/B1-561[»]
6DDXX-ray2.90A1-536[»]
6DDYX-ray1.80A1-536[»]
6DDZX-ray1.97A1-536[»]
6DE0X-ray2.05A1-523[»]
6DE1X-ray2.15A1-561[»]
6DE2X-ray2.10A1-561[»]
6DE3X-ray3.06A1-561[»]
ProteinModelPortaliP49902
SMRiP49902
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116627, 35 interactors
IntActiP49902, 14 interactors
MINTiP49902
STRINGi9606.ENSP00000339479

Chemistry databases

ChEMBLiCHEMBL3708197
DrugBankiDB00171 Adenosine triphosphate
DB00811 Ribavirin

PTM databases

DEPODiP49902
iPTMnetiP49902
PhosphoSitePlusiP49902

Polymorphism and mutation databases

BioMutaiNT5C2
DMDMi1703012

Proteomic databases

EPDiP49902
MaxQBiP49902
PaxDbiP49902
PeptideAtlasiP49902
PRIDEiP49902
ProteomicsDBi56174
TopDownProteomicsiP49902-1 [P49902-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
22978
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343289; ENSP00000339479; ENSG00000076685 [P49902-1]
ENST00000404739; ENSP00000383960; ENSG00000076685 [P49902-1]
GeneIDi22978
KEGGihsa:22978
UCSCiuc001kwq.4 human [P49902-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22978
DisGeNETi22978
EuPathDBiHostDB:ENSG00000076685.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NT5C2
HGNCiHGNC:8022 NT5C2
HPAiHPA003751
MalaCardsiNT5C2
MIMi600417 gene
613162 phenotype
neXtProtiNX_P49902
OpenTargetsiENSG00000076685
Orphaneti320396 Autosomal recessive spastic paraplegia type 45
PharmGKBiPA31801

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2469 Eukaryota
ENOG410XQAV LUCA
GeneTreeiENSGT00940000162369
HOGENOMiHOG000246075
HOVERGENiHBG000025
KOiK01081
OMAiACLYTSR
OrthoDBiEOG091G074N
PhylomeDBiP49902
TreeFamiTF315266

Enzyme and pathway databases

BioCyciMetaCyc:HS01216-MONOMER
BRENDAi3.1.3.5 2681
ReactomeiR-HSA-2161541 Abacavir metabolism
R-HSA-74259 Purine catabolism
SABIO-RKiP49902

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NT5C2 human
EvolutionaryTraceiP49902

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22978

Protein Ontology

More...
PROi
PR:P49902

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000076685 Expressed in 233 organ(s), highest expression level in ectocervix
CleanExiHS_NT5C2
ExpressionAtlasiP49902 baseline and differential
GenevisibleiP49902 HS

Family and domain databases

Gene3Di3.40.50.1000, 2 hits
InterProiView protein in InterPro
IPR036412 HAD-like_sf
IPR008380 HAD-SF_hydro_IG_5-nucl
IPR023214 HAD_sf
IPR016695 Pur_nucleotidase
PANTHERiPTHR12103 PTHR12103, 1 hit
PfamiView protein in Pfam
PF05761 5_nucleotid, 1 hit
PIRSFiPIRSF017434 Purine_5'-nucleotidase, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR02244 HAD-IG-Ncltidse, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei5NTC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49902
Secondary accession number(s): B7Z382, D3DR91, Q5JUV5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: December 5, 2018
This is version 176 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again