Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (17 Jun 2020)
Sequence version 3 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Type I iodothyronine deiodinase

Gene

DIO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) and of T3 into T2 (3,3'-diiodothyronine). Plays a role in providing a source of plasma T3 by deiodination of T4 in peripheral tissues such as liver and kidney.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1261

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processThyroid hormones biosynthesis

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.97.1.10 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-350864 Regulation of thyroid hormone activity

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
P49895

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Type I iodothyronine deiodinase (EC:1.21.99.4)
Alternative name(s):
5DI
DIOI
Type 1 DI
Type-I 5'-deiodinase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DIO1
Synonyms:ITDI1, TXDI1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000211452.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2883 DIO1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
147892 gene+phenotype

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49895

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei13 – 33HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1733
MIMi147892 gene+phenotype

Open Targets

More...
OpenTargetsi
ENSG00000211452

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27337

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P49895 Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2019

DrugCentral

More...
DrugCentrali
P49895

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DIO1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
182702125

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001543111 – 249Type I iodothyronine deiodinaseAdd BLAST249

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P49895

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P49895

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49895

PeptideAtlas

More...
PeptideAtlasi
P49895

PRoteomics IDEntifications database

More...
PRIDEi
P49895

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
56164 [P49895-1]
56165 [P49895-2]
56166 [P49895-3]
56167 [P49895-4]
56168 [P49895-5]
56169 [P49895-6]
56170 [P49895-7]
56171 [P49895-8]
56172 [P49895-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49895

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49895

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000211452 Expressed in liver and 95 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49895 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49895 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000211452 Group enriched (kidney, liver, thyroid gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354643

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P49895 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the iodothyronine deiodinase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IWHX Eukaryota
ENOG4112999 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154482

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_089345_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49895

KEGG Orthology (KO)

More...
KOi
K01562

Identification of Orthologs from Complete Genome Data

More...
OMAi
MYKLDEF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49895

TreeFam database of animal gene trees

More...
TreeFami
TF329721

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.30.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000643 Iodothyronine_deiodinase
IPR008261 Iodothyronine_deiodinase_AS
IPR027252 Iodothyronine_deiodinase_I/III
IPR036249 Thioredoxin-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11781 PTHR11781, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00837 T4_deiodinase, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001330 IOD, 1 hit
PIRSF500144 IODI_III, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52833 SSF52833, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01205 T4_DEIODINASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P49895-1) [UniParc]FASTAAdd to basket
Also known as: a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLPQPGLWL KRLWVLLEVA VHVVVGKVLL ILFPDRVKRN ILAMGEKTGM
60 70 80 90 100
TRNPHFSHDN WIPTFFSTQY FWFVLKVRWQ RLEDTTELGG LAPNCPVVRL
110 120 130 140 150
SGQRCNIWEF MQGNRPLVLN FGSCTUPSFM FKFDQFKRLI EDFSSIADFL
160 170 180 190 200
VIYIEEAHAS DGWAFKNNMD IRNHQNLQDR LQAAHLLLAR SPQCPVVVDT
210 220 230 240
MQNQSSQLYA ALPERLYIIQ EGRILYKGKS GPWNYNPEEV RAVLEKLHS
Length:249
Mass (Da):28,924
Last modified:February 26, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2D8BBFBA54B5A927
GO
Isoform 2 (identifier: P49895-2) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     50-113: Missing.

Show »
Length:185
Mass (Da):21,252
Checksum:i91E53DDDFC99E838
GO
Isoform 3 (identifier: P49895-3) [UniParc]FASTAAdd to basket
Also known as: c/f

The sequence of this isoform differs from the canonical sequence as follows:
     78-109: RWQRLEDTTELGGLAPNCPVVRLSGQRCNIWE → IGHWCUILEVVPDLHLCSNLTSSRGLLKTLVP
     110-249: Missing.

Note: The UGA codon in position 83 may either function as a selenocysteine codon or a translation termination codon.Curated
Show »
Length:109
Mass (Da):12,581
Checksum:i11293D50D43993E9
GO
Isoform 4 (identifier: P49895-4) [UniParc]FASTAAdd to basket
Also known as: d

The sequence of this isoform differs from the canonical sequence as follows:
     113-160: Missing.

Show »
Length:201
Mass (Da):23,390
Checksum:i04CBA7E9DFCC49FF
GO
Isoform 5 (identifier: P49895-5) [UniParc]FASTAAdd to basket
Also known as: e

The sequence of this isoform differs from the canonical sequence as follows:
     161-161: D → G
     162-249: Missing.

Show »
Length:161
Mass (Da):18,712
Checksum:i925FC41D8C359953
GO
Isoform 6 (identifier: P49895-6) [UniParc]FASTAAdd to basket
Also known as: k

The sequence of this isoform differs from the canonical sequence as follows:
     26-40: GKVLLILFPDRVKRN → APSISGSSURSVGSD
     41-249: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 34 may either function as a selenocysteine codon or a translation termination codon.Curated
Show »
Length:40
Mass (Da):4,292
Checksum:i0C907B0BF69B85FE
GO
Isoform 7 (identifier: P49895-7) [UniParc]FASTAAdd to basket
Also known as: l

The sequence of this isoform differs from the canonical sequence as follows:
     114-249: Missing.

Show »
Length:113
Mass (Da):13,178
Checksum:i4C437DDA41E76153
GO
Isoform 8 (identifier: P49895-8) [UniParc]FASTAAdd to basket
Also known as: m

The sequence of this isoform differs from the canonical sequence as follows:
     50-85: MTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDT → PLAATRGHDUARGSGPKLPGGPPLRTEVQHLGVYAR
     86-249: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 59 may either function as a selenocysteine codon or a translation termination codon.Curated
Show »
Length:85
Mass (Da):9,270
Checksum:i3885B86A586951FC
GO
Isoform 9 (identifier: P49895-9) [UniParc]FASTAAdd to basket
Also known as: s

The sequence of this isoform differs from the canonical sequence as follows:
     50-89: MTRNPHFSHD...QRLEDTTELG → PLAATRGHDU...LGVYARWLGF
     90-249: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 59 may either function as a selenocysteine codon or a translation termination codon.Curated
Show »
Length:89
Mass (Da):9,774
Checksum:i131E31116885B86A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WVX4A0A087WVX4_HUMAN
Iodothyronine deiodinase
DIO1
248Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYB0A0A087WYB0_HUMAN
Iodothyronine deiodinase
DIO1
160Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C6ZRC2C6ZRC2_HUMAN
Iodothyronine deiodinase
DIO1
117Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PI35E9PI35_HUMAN
Iodothyronine deiodinase
DIO1
82Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A182DWI2A0A182DWI2_HUMAN
Iodothyronine deiodinase
DIO1
184Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RP93F6RP93_HUMAN
Iodothyronine deiodinase
DIO1 hCG_1790306
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PM07E9PM07_HUMAN
Type I iodothyronine deiodinase
DIO1
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X0G2A0A087X0G2_HUMAN
Type I iodothyronine deiodinase
DIO1
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01277226 – 40GKVLL…RVKRN → APSISGSSURSVGSD in isoform 6. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_01277341 – 249Missing in isoform 6. 1 PublicationAdd BLAST209
Alternative sequenceiVSP_01277450 – 113Missing in isoform 2. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_01277950 – 89MTRNP…TTELG → PLAATRGHDUARGSGPKLPG GPPLRTEVQHLGVYARWLGF in isoform 9. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_01277550 – 85MTRNP…RLEDT → PLAATRGHDUARGSGPKLPG GPPLRTEVQHLGVYAR in isoform 8. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_01277778 – 109RWQRL…CNIWE → IGHWCUILEVVPDLHLCSNL TSSRGLLKTLVP in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_01277686 – 249Missing in isoform 8. 1 PublicationAdd BLAST164
Alternative sequenceiVSP_01278090 – 249Missing in isoform 9. 1 PublicationAdd BLAST160
Alternative sequenceiVSP_012778110 – 249Missing in isoform 3. 1 PublicationAdd BLAST140
Alternative sequenceiVSP_012781113 – 160Missing in isoform 4. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_012782114 – 249Missing in isoform 7. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_012783161D → G in isoform 5. 2 Publications1
Alternative sequenceiVSP_012784162 – 249Missing in isoform 5. 2 PublicationsAdd BLAST88

Non-standard residue

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the occurrence of non-standard amino acids selenocysteine (Sec) or pyrrolysine (Pyl) in the protein sequence.<p><a href='/help/non_std' target='_top'>More...</a></p>Non-standard residuei126Selenocysteine1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
S48220 mRNA Translation: AAB23670.2
AY560374 mRNA Translation: AAT02480.1
AY560375 mRNA Translation: AAT02481.1
AY560376 mRNA Translation: AAT02482.1
AY560377 mRNA Translation: AAT02483.1
AY560378 mRNA Translation: AAT02484.1
AY560379 mRNA Translation: AAT02485.1
AY560380 mRNA Translation: AAT02486.1
AY560381 mRNA Translation: AAT02487.1
AY560382 mRNA Translation: AAT02488.1
AY560383 mRNA Translation: AAT02489.1
AL031427 Genomic DNA No translation available.
BC017955 mRNA Translation: AAH17955.2
BC107170 mRNA Translation: AAI07171.1
BC107171 mRNA Translation: AAI07172.1
S79349 Genomic DNA Translation: AAB35380.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30722.1 [P49895-4]
CCDS41339.1 [P49895-1]
CCDS41340.1 [P49895-5]
CCDS53320.1 [P49895-2]
CCDS81328.1 [P49895-7]

NCBI Reference Sequences

More...
RefSeqi
NP_000783.2, NM_000792.6 [P49895-1]
NP_001034804.1, NM_001039715.2 [P49895-4]
NP_001034805.1, NM_001039716.2 [P49895-5]
NP_001311245.1, NM_001324316.1 [P49895-7]
NP_998758.1, NM_213593.4 [P49895-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000322679; ENSP00000323198; ENSG00000211452 [P49895-5]
ENST00000361921; ENSP00000354643; ENSG00000211452 [P49895-1]
ENST00000388876; ENSP00000373528; ENSG00000211452 [P49895-4]
ENST00000525202; ENSP00000435725; ENSG00000211452 [P49895-2]
ENST00000532493; ENSP00000434758; ENSG00000211452 [P49895-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1733

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1733

UCSC genome browser

More...
UCSCi
uc001cwb.4 human [P49895-1]

Keywords - Coding sequence diversityi

Alternative splicing, Selenocysteine

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Deiodinase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S48220 mRNA Translation: AAB23670.2
AY560374 mRNA Translation: AAT02480.1
AY560375 mRNA Translation: AAT02481.1
AY560376 mRNA Translation: AAT02482.1
AY560377 mRNA Translation: AAT02483.1
AY560378 mRNA Translation: AAT02484.1
AY560379 mRNA Translation: AAT02485.1
AY560380 mRNA Translation: AAT02486.1
AY560381 mRNA Translation: AAT02487.1
AY560382 mRNA Translation: AAT02488.1
AY560383 mRNA Translation: AAT02489.1
AL031427 Genomic DNA No translation available.
BC017955 mRNA Translation: AAH17955.2
BC107170 mRNA Translation: AAI07171.1
BC107171 mRNA Translation: AAI07172.1
S79349 Genomic DNA Translation: AAB35380.2
CCDSiCCDS30722.1 [P49895-4]
CCDS41339.1 [P49895-1]
CCDS41340.1 [P49895-5]
CCDS53320.1 [P49895-2]
CCDS81328.1 [P49895-7]
RefSeqiNP_000783.2, NM_000792.6 [P49895-1]
NP_001034804.1, NM_001039715.2 [P49895-4]
NP_001034805.1, NM_001039716.2 [P49895-5]
NP_001311245.1, NM_001324316.1 [P49895-7]
NP_998758.1, NM_213593.4 [P49895-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9606.ENSP00000354643

Chemistry databases

ChEMBLiCHEMBL2019
DrugCentraliP49895

PTM databases

iPTMnetiP49895
PhosphoSitePlusiP49895

Polymorphism and mutation databases

BioMutaiDIO1
DMDMi182702125

Proteomic databases

EPDiP49895
MassIVEiP49895
PaxDbiP49895
PeptideAtlasiP49895
PRIDEiP49895
ProteomicsDBi56164 [P49895-1]
56165 [P49895-2]
56166 [P49895-3]
56167 [P49895-4]
56168 [P49895-5]
56169 [P49895-6]
56170 [P49895-7]
56171 [P49895-8]
56172 [P49895-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33120 111 antibodies

Genome annotation databases

EnsembliENST00000322679; ENSP00000323198; ENSG00000211452 [P49895-5]
ENST00000361921; ENSP00000354643; ENSG00000211452 [P49895-1]
ENST00000388876; ENSP00000373528; ENSG00000211452 [P49895-4]
ENST00000525202; ENSP00000435725; ENSG00000211452 [P49895-2]
ENST00000532493; ENSP00000434758; ENSG00000211452 [P49895-7]
GeneIDi1733
KEGGihsa:1733
UCSCiuc001cwb.4 human [P49895-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1733
DisGeNETi1733
EuPathDBiHostDB:ENSG00000211452.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DIO1
HGNCiHGNC:2883 DIO1
HPAiENSG00000211452 Group enriched (kidney, liver, thyroid gland)
MIMi147892 gene+phenotype
neXtProtiNX_P49895
OpenTargetsiENSG00000211452
PharmGKBiPA27337

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IWHX Eukaryota
ENOG4112999 LUCA
GeneTreeiENSGT00940000154482
HOGENOMiCLU_089345_2_0_1
InParanoidiP49895
KOiK01562
OMAiMYKLDEF
PhylomeDBiP49895
TreeFamiTF329721

Enzyme and pathway databases

BRENDAi1.97.1.10 2681
ReactomeiR-HSA-350864 Regulation of thyroid hormone activity
SABIO-RKiP49895

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
1733 0 hits in 786 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DIO1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1733
PharosiP49895 Tclin

Protein Ontology

More...
PROi
PR:P49895
RNActiP49895 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000211452 Expressed in liver and 95 other tissues
ExpressionAtlasiP49895 baseline and differential
GenevisibleiP49895 HS

Family and domain databases

Gene3Di3.40.30.10, 1 hit
InterProiView protein in InterPro
IPR000643 Iodothyronine_deiodinase
IPR008261 Iodothyronine_deiodinase_AS
IPR027252 Iodothyronine_deiodinase_I/III
IPR036249 Thioredoxin-like_sf
PANTHERiPTHR11781 PTHR11781, 1 hit
PfamiView protein in Pfam
PF00837 T4_deiodinase, 1 hit
PIRSFiPIRSF001330 IOD, 1 hit
PIRSF500144 IODI_III, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit
PROSITEiView protein in PROSITE
PS01205 T4_DEIODINASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIOD1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49895
Secondary accession number(s): Q1RN02
, Q3KNP8, Q6Q4C1, Q6Q4C2, Q6Q4C3, Q6Q4C4, Q6Q4C5, Q6Q4C6, Q6Q4C7, Q6Q4C9, Q8WWC6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: February 26, 2008
Last modified: June 17, 2020
This is version 178 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again