Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (08 May 2019)
Sequence version 3 (14 May 2014)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transcription factor HNF-4 homolog

Gene

Hnf4

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptionally controlled transcription factor. Important for the differentiation of various specialized cell types that arise from both endoderm and mesoderm. May have a role in early gut formation. Plays an essential role in lipid catabolism, regulating lipid mobilization and beta-oxidation in response to nutrient deprivation.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi139 – 214Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri142 – 162NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri178 – 197NR C4-typePROSITE-ProRule annotationAdd BLAST20

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Receptor
Biological processLipid degradation, Lipid metabolism, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-383280 Nuclear Receptor transcription pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor HNF-4 homolog
Short name:
dHNF4
Alternative name(s):
Nuclear receptor subfamily 2 group A member 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Hnf4
Synonyms:NR2A4
ORF Names:CG9310
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0004914 Hnf4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Under normal culture conditions, the flies progress through development until they die during or shortly after adult eclosion. Under low density culture conditions, many flies survive and develop into morphologically normal adults. The mutant flies are, however, very sensitive to starvation, displaying inability to efficiently mobilize stored lipid in the midgut and fat body, increased levels of long-chain fatty acids and triglycerides, and premature death.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000535651 – 704Transcription factor HNF-4 homologAdd BLAST704

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49866

PRoteomics IDEntifications database

More...
PRIDEi
P49866

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In third instar larvae, expressed at high levels in midgut and attached gastric caeca, fat body, Malpighian tubules and oenocytes, and at lower levels in proventriculus, salivary glands, epidermis, brain and ring gland. Not detected in imaginal disks and the median neurosecretory cells that produce insulin-like peptides (at protein level). In developing embryos, expressed in mid-gut, fat bodies and the distal region of Malpighian tubules.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0004914 Expressed in 44 organ(s), highest expression level in thoracico-abdominal ganglion (Drosophila)

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49866 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49866 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
69122, 6 interactors

Database of interacting proteins

More...
DIPi
DIP-19209N

Protein interaction database and analysis system

More...
IntActi
P49866, 2 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0079350

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49866

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini232 – 470NR LBDPROSITE-ProRule annotationAdd BLAST239

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi104 – 107Poly-Asn4
Compositional biasi127 – 137Poly-GlnAdd BLAST11
Compositional biasi530 – 569Ala-richAdd BLAST40
Compositional biasi591 – 594Poly-Gln4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri142 – 162NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri178 – 197NR C4-typePROSITE-ProRule annotationAdd BLAST20

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4215 Eukaryota
ENOG410XQT8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000167734

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49866

KEGG Orthology (KO)

More...
KOi
K08704

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.565.10, 1 hit
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035500 NHR-like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR000003 Retinoid-X_rcpt/HNF4
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00545 RETINOIDXR
PR00398 STRDHORMONER
PR00047 STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48508 SSF48508, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform A (identifier: P49866-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMKHPQDLSV TDDQQLMKVN KVEKMEQELH DPESESHIMH ADALASAYPA
60 70 80 90 100
ASQPHSPIGL ALSPNGGGLG LSNSSNQSSE NFALCNGNGN AGSAGGGSAS
110 120 130 140 150
SGSNNNNSMF SPNNNLSGSG SGTNSSQQQL QQQQQQQSPT VCAICGDRAT
160 170 180 190 200
GKHYGASSCD GCKGFFRRSV RKNHQYTCRF ARNCVVDKDK RNQCRYCRLR
210 220 230 240 250
KCFKAGMKKE AVQNERDRIS CRRTSNDDPD PGNGLSVISL VKAENESRQS
260 270 280 290 300
KAGAAMEPNI NEDLSNKQFA SINDVCESMK QQLLTLVEWA KQIPAFNELQ
310 320 330 340 350
LDDQVALLRA HAGEHLLLGL SRRSMHLKDV LLLSNNCVIT RHCPDPLVSP
360 370 380 390 400
NLDISRIGAR IIDELVTVMK DVGIDDTEFA CIKALVFFDP NAKGLNEPHR
410 420 430 440 450
IKSLRHQILN NLEDYISDRQ YESRGRFGEI LLILPVLQSI TWQMIEQIQF
460 470 480 490 500
AKIFGVAHID SLLQEMLLGG ELADNPLPLS PPNQSNDYQS PTHTGNMEGG
510 520 530 540 550
NQVNSSLDSL ATSGGPGSHS LDLEVQHIQA LIEANSADDS FRAYAASTAA
560 570 580 590 600
AAAAAVSSSS SAPASVAPAS ISPPLNSPKS QHQHQQHATH QQQQESSYLD
610 620 630 640 650
MPVKHYNGSR SGPLPTQHSP QRMHPYQRAV ASPVEVSSGG GGLGLRNPAD
660 670 680 690 700
ITLNEYNRSE GSSAEELLRR TPLKIRAPEM LTAPAGYGTE PCRMTLKQEP

ETGY
Length:704
Mass (Da):76,388
Last modified:May 14, 2014 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5868280AFE7A00CC
GO
Isoform D (identifier: P49866-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MMKHPQDLSVTDDQQLMKVNKVEKMEQELHDP → MYASMLPSLLNMKTENLTSSSYDDAFLLEENLLHIM

Note: No experimental confirmation available.
Show »
Length:708
Mass (Da):76,702
Checksum:i6ECF7DA166C6B517
GO
Isoform B (identifier: P49866-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MMKHPQDLSVTDDQQLMKVNKVEKMEQELHDP → MVRKSGRVKI...SSASRTASSD

Show »
Length:732
Mass (Da):78,959
Checksum:i2854A4A7EB552420
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X2J9X1X2J9X1_DROME
Hepatocyte nuclear factor 4, isofor...
Hnf4 CG9310, dHNF-4, dHNF4, Dmel\CG9310, DmHNF4
666Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB09592 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAN71555 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence ACS68165 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti113N → Y in AAB09592 (PubMed:8440243).Curated1
Sequence conflicti117S → N in AAB09592 (PubMed:8440243).Curated1
Sequence conflicti159C → F in AAN71555 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0545781 – 32MMKHP…ELHDP → MVRKSGRVKISSRDRVAVGN ILLRGKVGGGRVAVAAAEEA EAGRRRRRRDSSASRTASSD in isoform B. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_0545771 – 32MMKHP…ELHDP → MYASMLPSLLNMKTENLTSS SYDDAFLLEENLLHIM in isoform D. CuratedAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U70874 mRNA Translation: AAB09592.1 Different initiation.
AE014134 Genomic DNA Translation: AAF52702.2
AE014134 Genomic DNA Translation: AAF52703.2
AE014134 Genomic DNA Translation: AAN10680.1
AE014134 Genomic DNA Translation: ABV53653.1
BT001800 mRNA Translation: AAN71555.1 Different initiation.
BT003533 mRNA Translation: AAO39537.1
BT088848 mRNA Translation: ACS68165.1 Different initiation.

Protein sequence database of the Protein Information Resource

More...
PIRi
S36218

NCBI Reference Sequences

More...
RefSeqi
NP_001097126.1, NM_001103656.3 [P49866-2]
NP_476887.2, NM_057539.5 [P49866-1]
NP_723413.1, NM_164833.2 [P49866-3]
NP_723414.2, NM_164834.2 [P49866-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0079747; FBpp0079349; FBgn0004914 [P49866-1]
FBtr0079748; FBpp0079350; FBgn0004914 [P49866-3]
FBtr0112846; FBpp0111759; FBgn0004914 [P49866-2]
FBtr0336633; FBpp0307616; FBgn0004914 [P49866-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
44544

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG9310

UCSC genome browser

More...
UCSCi
CG9310-RA d. melanogaster
CG9310-RB d. melanogaster
CG9310-RD d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70874 mRNA Translation: AAB09592.1 Different initiation.
AE014134 Genomic DNA Translation: AAF52702.2
AE014134 Genomic DNA Translation: AAF52703.2
AE014134 Genomic DNA Translation: AAN10680.1
AE014134 Genomic DNA Translation: ABV53653.1
BT001800 mRNA Translation: AAN71555.1 Different initiation.
BT003533 mRNA Translation: AAO39537.1
BT088848 mRNA Translation: ACS68165.1 Different initiation.
PIRiS36218
RefSeqiNP_001097126.1, NM_001103656.3 [P49866-2]
NP_476887.2, NM_057539.5 [P49866-1]
NP_723413.1, NM_164833.2 [P49866-3]
NP_723414.2, NM_164834.2 [P49866-1]

3D structure databases

SMRiP49866
ModBaseiSearch...

Protein-protein interaction databases

BioGridi69122, 6 interactors
DIPiDIP-19209N
IntActiP49866, 2 interactors
STRINGi7227.FBpp0079350

Proteomic databases

PaxDbiP49866
PRIDEiP49866

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0079747; FBpp0079349; FBgn0004914 [P49866-1]
FBtr0079748; FBpp0079350; FBgn0004914 [P49866-3]
FBtr0112846; FBpp0111759; FBgn0004914 [P49866-2]
FBtr0336633; FBpp0307616; FBgn0004914 [P49866-1]
GeneIDi44544
KEGGidme:Dmel_CG9310
UCSCiCG9310-RA d. melanogaster
CG9310-RB d. melanogaster
CG9310-RD d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
44544
FlyBaseiFBgn0004914 Hnf4

Phylogenomic databases

eggNOGiKOG4215 Eukaryota
ENOG410XQT8 LUCA
GeneTreeiENSGT00940000167734
InParanoidiP49866
KOiK08704

Enzyme and pathway databases

ReactomeiR-DME-383280 Nuclear Receptor transcription pathway

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
44544

Protein Ontology

More...
PROi
PR:P49866

Gene expression databases

BgeeiFBgn0004914 Expressed in 44 organ(s), highest expression level in thoracico-abdominal ganglion (Drosophila)
ExpressionAtlasiP49866 baseline and differential
GenevisibleiP49866 DM

Family and domain databases

Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR-like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR000003 Retinoid-X_rcpt/HNF4
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR00545 RETINOIDXR
PR00398 STRDHORMONER
PR00047 STROIDFINGER
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHNF4_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49866
Secondary accession number(s): A8DYX8
, C5WLN3, Q8IGG2, Q8IPF2, Q9VLI7, Q9VLI8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: May 14, 2014
Last modified: May 8, 2019
This is version 164 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again