Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 190 (22 Apr 2020)
Sequence version 3 (18 Oct 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Regulator of G-protein signaling 7

Gene

RGS7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:10521509, PubMed:10862767). The RGS7/GNB5 dimer enhances GNAO1 GTPase activity (PubMed:10521509). May play a role in synaptic vesicle exocytosis (PubMed:12659861). Modulates the activity of potassium channels that are activated by GNAO1 in response to muscarinic acetylcholine receptor M2/CHRM2 signaling (PubMed:15897264).1 Publication3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation, Signal transduction inhibitor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418594 G alpha (i) signalling events
R-HSA-6814122 Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P49802

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Regulator of G-protein signaling 7
Short name:
RGS7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RGS7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10003 RGS7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602517 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49802

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi306W → F: Diminishes interaction with GNB5. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6000

Open Targets

More...
OpenTargetsi
ENSG00000182901

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34378

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P49802 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RGS7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
17380284

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002041961 – 495Regulator of G-protein signaling 7Add BLAST495

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei229PhosphoserineBy similarity1
Modified residuei241PhosphoserineBy similarity1
Modified residuei243PhosphothreonineBy similarity1
Modified residuei434Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated.By similarity
Ubiquitinated, leading to rapid proteasomal degradation.1 Publication
Phosphorylation and subsequent interaction with 14-3-3 proteins inhibits GAP activity.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P49802

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P49802

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49802

PeptideAtlas

More...
PeptideAtlasi
P49802

PRoteomics IDEntifications database

More...
PRIDEi
P49802

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
56134 [P49802-1]
56135 [P49802-2]
56136 [P49802-3]
56137 [P49802-4]
56138 [P49802-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49802

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49802

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P49802

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182901 Expressed in endothelial cell and 114 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49802 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49802 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000182901 Tissue enhanced (adrenal gland, brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PKD1; this prevents rapid proteasomal degradation (PubMed:10339594).

Interacts with GNB5 (PubMed:10521509, PubMed:10339615).

Interacts with RGS7BP, leading to regulate the subcellular location of the heterodimer formed with GNB5 (PubMed:15897264).

Interacts (phosphorylated form) with 14-3-3 protein YWHAQ (PubMed:10862767).

Interacts with SNAPIN (PubMed:12659861).

Interacts with GNAI1 (PubMed:18434541).

Interacts with GNAO1, GNAI3 and GNAZ (By similarity).

By similarity6 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111932, 13 interactors

Database of interacting proteins

More...
DIPi
DIP-40869N

Protein interaction database and analysis system

More...
IntActi
P49802, 9 interactors

Molecular INTeraction database

More...
MINTi
P49802

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000355523

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P49802

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P49802 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1495
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49802

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P49802

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 112DEPPROSITE-ProRule annotationAdd BLAST76
Domaini255 – 316G protein gammaAdd BLAST62
Domaini333 – 448RGSPROSITE-ProRule annotationAdd BLAST116

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3589 Eukaryota
ENOG410YMJD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156661

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49802

KEGG Orthology (KO)

More...
KOi
K16449

Identification of Orthologs from Complete Genome Data

More...
OMAi
SHGYLFQ

Database of Orthologous Groups

More...
OrthoDBi
415625at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49802

TreeFam database of animal gene trees

More...
TreeFami
TF351956

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00068 GGL, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000591 DEP_dom
IPR015898 G-protein_gamma-like_dom
IPR036284 GGL_sf
IPR016137 RGS
IPR040759 RGS_DHEX
IPR036305 RGS_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00610 DEP, 1 hit
PF00631 G-gamma, 1 hit
PF00615 RGS, 1 hit
PF18148 RGS_DHEX, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01301 RGSPROTEIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00049 DEP, 1 hit
SM00224 GGL, 1 hit
SM00315 RGS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 1 hit
SSF48097 SSF48097, 1 hit
SSF48670 SSF48670, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50186 DEP, 1 hit
PS50132 RGS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P49802-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQGNNYGQT SNGVADESPN MLVYRKMEDV IARMQDEKNG IPIRTVKSFL
60 70 80 90 100
SKIPSVFSGS DIVQWLIKNL TIEDPVEALH LGTLMAAHGY FFPISDHVLT
110 120 130 140 150
LKDDGTFYRF QTPYFWPSNC WEPENTDYAV YLCKRTMQNK ARLELADYEA
160 170 180 190 200
ESLARLQRAF ARKWEFIFMQ AEAQAKVDKK RDKIERKILD SQERAFWDVH
210 220 230 240 250
RPVPGCVNTT EVDIKKSSRM RNPHKTRKSV YGLQNDIRSH SPTHTPTPET
260 270 280 290 300
KPPTEDELQQ QIKYWQIQLD RHRLKMSKVA DSLLSYTEQY LEYDPFLLPP
310 320 330 340 350
DPSNPWLSDD TTFWELEASK EPSQQRVKRW GFGMDEALKD PVGREQFLKF
360 370 380 390 400
LESEFSSENL RFWLAVEDLK KRPIKEVPSR VQEIWQEFLA PGAPSAINLD
410 420 430 440 450
SKSYDKTTQN VKEPGRYTFE DAQEHIYKLM KSDSYPRFIR SSAYQELLQA
460 470 480 490
KKKSGNSMDR RTSFEKFAQN VGRNIPIFPC HKNCTPTLRA STNLL
Length:495
Mass (Da):57,668
Last modified:October 18, 2001 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1FCC2D60622675DE
GO
Isoform 2 (identifier: P49802-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     454-495: SGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRASTNLL → GKSLTSKRLTSLAQSY

Show »
Length:469
Mass (Da):54,685
Checksum:i993C1209EDD884EC
GO
Isoform 3 (identifier: P49802-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-471: Missing.

Show »
Length:477
Mass (Da):55,612
Checksum:iA7252A838E1881A9
GO
Isoform 4 (identifier: P49802-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-128: Missing.
     454-471: Missing.

Show »
Length:424
Mass (Da):49,387
Checksum:i25A8A2F507C07E87
GO
Isoform 5 (identifier: P49802-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     473-495: RNIPIFPCHKNCTPTLRASTNLL → KSLTSKRLTSLAQSY

Show »
Length:487
Mass (Da):56,741
Checksum:i50BDD0E8896444BC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T3H5Q5T3H5_HUMAN
Regulator of G-protein-signaling 7
RGS7
326Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti26K → R in AAM12645 (Ref. 3) Curated1
Sequence conflicti234Q → R in AAM12644 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057153137M → L. Corresponds to variant dbSNP:rs12746550Ensembl.1
Natural variantiVAR_060604409Q → H1 PublicationCorresponds to variant dbSNP:rs17851953Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00567176 – 128Missing in isoform 4. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_005672454 – 495SGNSM…STNLL → GKSLTSKRLTSLAQSY in isoform 2. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_005673454 – 471Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_038388473 – 495RNIPI…STNLL → KSLTSKRLTSLAQSY in isoform 5. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF090116 mRNA Translation: AAD34290.1
AF090117 mRNA Translation: AAD34291.1
U32439 mRNA Translation: AAC50351.1
AF493930 mRNA Translation: AAM12644.1
AF493931 mRNA Translation: AAM12645.1
AY587875 mRNA Translation: AAT52231.1
AL359764 Genomic DNA No translation available.
AL365184 Genomic DNA No translation available.
AL512307 Genomic DNA No translation available.
AL590682 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW70086.1
BC022009 mRNA Translation: AAH22009.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31071.1 [P49802-5]
CCDS60457.1 [P49802-4]
CCDS60458.1 [P49802-2]
CCDS60459.1 [P49802-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001269702.1, NM_001282773.1 [P49802-4]
NP_001269704.1, NM_001282775.1 [P49802-3]
NP_001269707.1, NM_001282778.1 [P49802-2]
NP_002915.3, NM_002924.5 [P49802-5]
XP_005273275.1, XM_005273218.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000348120; ENSP00000341242; ENSG00000182901 [P49802-4]
ENST00000366563; ENSP00000355521; ENSG00000182901 [P49802-3]
ENST00000366564; ENSP00000355522; ENSG00000182901 [P49802-2]
ENST00000366565; ENSP00000355523; ENSG00000182901 [P49802-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6000

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6000

UCSC genome browser

More...
UCSCi
uc001hyu.4 human [P49802-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF090116 mRNA Translation: AAD34290.1
AF090117 mRNA Translation: AAD34291.1
U32439 mRNA Translation: AAC50351.1
AF493930 mRNA Translation: AAM12644.1
AF493931 mRNA Translation: AAM12645.1
AY587875 mRNA Translation: AAT52231.1
AL359764 Genomic DNA No translation available.
AL365184 Genomic DNA No translation available.
AL512307 Genomic DNA No translation available.
AL590682 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW70086.1
BC022009 mRNA Translation: AAH22009.1
CCDSiCCDS31071.1 [P49802-5]
CCDS60457.1 [P49802-4]
CCDS60458.1 [P49802-2]
CCDS60459.1 [P49802-3]
RefSeqiNP_001269702.1, NM_001282773.1 [P49802-4]
NP_001269704.1, NM_001282775.1 [P49802-3]
NP_001269707.1, NM_001282778.1 [P49802-2]
NP_002915.3, NM_002924.5 [P49802-5]
XP_005273275.1, XM_005273218.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A72X-ray2.00A/B320-463[»]
2D9JNMR-A323-448[»]
SMRiP49802
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi111932, 13 interactors
DIPiDIP-40869N
IntActiP49802, 9 interactors
MINTiP49802
STRINGi9606.ENSP00000355523

Chemistry databases

BindingDBiP49802

PTM databases

iPTMnetiP49802
PhosphoSitePlusiP49802
SwissPalmiP49802

Polymorphism and mutation databases

BioMutaiRGS7
DMDMi17380284

Proteomic databases

MassIVEiP49802
MaxQBiP49802
PaxDbiP49802
PeptideAtlasiP49802
PRIDEiP49802
ProteomicsDBi56134 [P49802-1]
56135 [P49802-2]
56136 [P49802-3]
56137 [P49802-4]
56138 [P49802-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
620 218 antibodies

The DNASU plasmid repository

More...
DNASUi
6000

Genome annotation databases

EnsembliENST00000348120; ENSP00000341242; ENSG00000182901 [P49802-4]
ENST00000366563; ENSP00000355521; ENSG00000182901 [P49802-3]
ENST00000366564; ENSP00000355522; ENSG00000182901 [P49802-2]
ENST00000366565; ENSP00000355523; ENSG00000182901 [P49802-5]
GeneIDi6000
KEGGihsa:6000
UCSCiuc001hyu.4 human [P49802-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6000
DisGeNETi6000

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RGS7
HGNCiHGNC:10003 RGS7
HPAiENSG00000182901 Tissue enhanced (adrenal gland, brain)
MIMi602517 gene
neXtProtiNX_P49802
OpenTargetsiENSG00000182901
PharmGKBiPA34378

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3589 Eukaryota
ENOG410YMJD LUCA
GeneTreeiENSGT00940000156661
InParanoidiP49802
KOiK16449
OMAiSHGYLFQ
OrthoDBi415625at2759
PhylomeDBiP49802
TreeFamiTF351956

Enzyme and pathway databases

ReactomeiR-HSA-418594 G alpha (i) signalling events
R-HSA-6814122 Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
SignaLinkiP49802

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RGS7 human
EvolutionaryTraceiP49802

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RGS7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6000
PharosiP49802 Tbio

Protein Ontology

More...
PROi
PR:P49802
RNActiP49802 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000182901 Expressed in endothelial cell and 114 other tissues
ExpressionAtlasiP49802 baseline and differential
GenevisibleiP49802 HS

Family and domain databases

CDDicd00068 GGL, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000591 DEP_dom
IPR015898 G-protein_gamma-like_dom
IPR036284 GGL_sf
IPR016137 RGS
IPR040759 RGS_DHEX
IPR036305 RGS_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00610 DEP, 1 hit
PF00631 G-gamma, 1 hit
PF00615 RGS, 1 hit
PF18148 RGS_DHEX, 1 hit
PRINTSiPR01301 RGSPROTEIN
SMARTiView protein in SMART
SM00049 DEP, 1 hit
SM00224 GGL, 1 hit
SM00315 RGS, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF48097 SSF48097, 1 hit
SSF48670 SSF48670, 1 hit
PROSITEiView protein in PROSITE
PS50186 DEP, 1 hit
PS50132 RGS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGS7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49802
Secondary accession number(s): Q5T3H4
, Q8TD66, Q8TD67, Q8WW09, Q9UNU7, Q9Y6B9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 18, 2001
Last modified: April 22, 2020
This is version 190 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again