Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of G-protein signaling 7

Gene

RGS7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:10521509, PubMed:10862767). The RGS7/GNB5 dimer enhances GNAO1 GTPase activity (PubMed:10521509). May play a role in synaptic vesicle exocytosis (PubMed:12659861). Modulates the activity of potassium channels that are activated by GNAO1 in response to muscarinic acetylcholine receptor M2/CHRM2 signaling (PubMed:15897264).1 Publication3 Publications

GO - Molecular functioni

  • G-protein beta-subunit binding Source: UniProtKB
  • GTPase activator activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionGTPase activation, Signal transduction inhibitor

Enzyme and pathway databases

ReactomeiR-HSA-418594 G alpha (i) signalling events
R-HSA-6814122 Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
SignaLinkiP49802

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 7
Short name:
RGS7
Gene namesi
Name:RGS7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000182901.15
HGNCiHGNC:10003 RGS7
MIMi602517 gene
neXtProtiNX_P49802

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi306W → F: Diminishes interaction with GNB5. 1 Publication1

Organism-specific databases

DisGeNETi6000
OpenTargetsiENSG00000182901
PharmGKBiPA34378

Polymorphism and mutation databases

DMDMi17380284

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002041961 – 495Regulator of G-protein signaling 7Add BLAST495

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei229PhosphoserineBy similarity1
Modified residuei241PhosphoserineBy similarity1
Modified residuei243PhosphothreonineBy similarity1
Modified residuei434Phosphoserine1 Publication1

Post-translational modificationi

Palmitoylated.By similarity
Ubiquitinated, leading to rapid proteasomal degradation.1 Publication
Phosphorylation and subsequent interaction with 14-3-3 proteins inhibits GAP activity.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP49802
MaxQBiP49802
PaxDbiP49802
PeptideAtlasiP49802
PRIDEiP49802
ProteomicsDBi56134
56135 [P49802-2]
56136 [P49802-3]
56137 [P49802-4]
56138 [P49802-5]

PTM databases

iPTMnetiP49802
PhosphoSitePlusiP49802
SwissPalmiP49802

Expressioni

Gene expression databases

BgeeiENSG00000182901 Expressed in 115 organ(s), highest expression level in endothelial cell
CleanExiHS_RGS7
ExpressionAtlasiP49802 baseline and differential
GenevisibleiP49802 HS

Organism-specific databases

HPAiCAB017561

Interactioni

Subunit structurei

Interacts with PKD1; this prevents rapid proteasomal degradation (PubMed:10339594). Interacts with GNB5 (PubMed:10521509, PubMed:10339615). Interacts with RGS7BP, leading to regulate the subcellular location of the heterodimer formed with GNB5 (PubMed:15897264). Interacts (phosphorylated form) with 14-3-3 protein YWHAQ (PubMed:10862767). Interacts with SNAPIN (PubMed:12659861). Interacts with GNAI1 (PubMed:18434541). Interacts with GNAO1, GNAI3 and GNAZ (By similarity).By similarity6 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111932, 8 interactors
DIPiDIP-40869N
IntActiP49802, 6 interactors
STRINGi9606.ENSP00000355523

Chemistry databases

BindingDBiP49802

Structurei

Secondary structure

1495
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP49802
SMRiP49802
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49802

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 112DEPPROSITE-ProRule annotationAdd BLAST76
Domaini255 – 316G protein gammaAdd BLAST62
Domaini333 – 448RGSPROSITE-ProRule annotationAdd BLAST116

Phylogenomic databases

eggNOGiKOG3589 Eukaryota
ENOG410YMJD LUCA
GeneTreeiENSGT00760000119142
HOVERGENiHBG007404
InParanoidiP49802
KOiK16449
OMAiSHGYLFQ
OrthoDBiEOG091G05MO
PhylomeDBiP49802
TreeFamiTF351956

Family and domain databases

CDDicd00068 GGL, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000591 DEP_dom
IPR015898 G-protein_gamma-like_dom
IPR036284 GGL_sf
IPR016137 RGS
IPR036305 RGS_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00610 DEP, 1 hit
PF00631 G-gamma, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR01301 RGSPROTEIN
SMARTiView protein in SMART
SM00049 DEP, 1 hit
SM00224 GGL, 1 hit
SM00315 RGS, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF48097 SSF48097, 1 hit
SSF48670 SSF48670, 1 hit
PROSITEiView protein in PROSITE
PS50186 DEP, 1 hit
PS50132 RGS, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P49802-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQGNNYGQT SNGVADESPN MLVYRKMEDV IARMQDEKNG IPIRTVKSFL
60 70 80 90 100
SKIPSVFSGS DIVQWLIKNL TIEDPVEALH LGTLMAAHGY FFPISDHVLT
110 120 130 140 150
LKDDGTFYRF QTPYFWPSNC WEPENTDYAV YLCKRTMQNK ARLELADYEA
160 170 180 190 200
ESLARLQRAF ARKWEFIFMQ AEAQAKVDKK RDKIERKILD SQERAFWDVH
210 220 230 240 250
RPVPGCVNTT EVDIKKSSRM RNPHKTRKSV YGLQNDIRSH SPTHTPTPET
260 270 280 290 300
KPPTEDELQQ QIKYWQIQLD RHRLKMSKVA DSLLSYTEQY LEYDPFLLPP
310 320 330 340 350
DPSNPWLSDD TTFWELEASK EPSQQRVKRW GFGMDEALKD PVGREQFLKF
360 370 380 390 400
LESEFSSENL RFWLAVEDLK KRPIKEVPSR VQEIWQEFLA PGAPSAINLD
410 420 430 440 450
SKSYDKTTQN VKEPGRYTFE DAQEHIYKLM KSDSYPRFIR SSAYQELLQA
460 470 480 490
KKKSGNSMDR RTSFEKFAQN VGRNIPIFPC HKNCTPTLRA STNLL
Length:495
Mass (Da):57,668
Last modified:October 18, 2001 - v3
Checksum:i1FCC2D60622675DE
GO
Isoform 2 (identifier: P49802-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     454-495: SGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRASTNLL → GKSLTSKRLTSLAQSY

Show »
Length:469
Mass (Da):54,685
Checksum:i993C1209EDD884EC
GO
Isoform 3 (identifier: P49802-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-471: Missing.

Show »
Length:477
Mass (Da):55,612
Checksum:iA7252A838E1881A9
GO
Isoform 4 (identifier: P49802-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-128: Missing.
     454-471: Missing.

Show »
Length:424
Mass (Da):49,387
Checksum:i25A8A2F507C07E87
GO
Isoform 5 (identifier: P49802-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     473-495: RNIPIFPCHKNCTPTLRASTNLL → KSLTSKRLTSLAQSY

Show »
Length:487
Mass (Da):56,741
Checksum:i50BDD0E8896444BC
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T3H5Q5T3H5_HUMAN
Regulator of G-protein-signaling 7
RGS7
326Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26K → R in AAM12645 (Ref. 3) Curated1
Sequence conflicti234Q → R in AAM12644 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057153137M → L. Corresponds to variant dbSNP:rs12746550Ensembl.1
Natural variantiVAR_060604409Q → H1 PublicationCorresponds to variant dbSNP:rs17851953Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00567176 – 128Missing in isoform 4. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_005672454 – 495SGNSM…STNLL → GKSLTSKRLTSLAQSY in isoform 2. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_005673454 – 471Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_038388473 – 495RNIPI…STNLL → KSLTSKRLTSLAQSY in isoform 5. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF090116 mRNA Translation: AAD34290.1
AF090117 mRNA Translation: AAD34291.1
U32439 mRNA Translation: AAC50351.1
AF493930 mRNA Translation: AAM12644.1
AF493931 mRNA Translation: AAM12645.1
AY587875 mRNA Translation: AAT52231.1
AL359764 Genomic DNA No translation available.
AL365184 Genomic DNA No translation available.
AL512307 Genomic DNA No translation available.
AL590682 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW70086.1
BC022009 mRNA Translation: AAH22009.1
CCDSiCCDS31071.1 [P49802-5]
CCDS60457.1 [P49802-4]
CCDS60458.1 [P49802-2]
CCDS60459.1 [P49802-3]
RefSeqiNP_001269702.1, NM_001282773.1 [P49802-4]
NP_001269704.1, NM_001282775.1 [P49802-3]
NP_001269707.1, NM_001282778.1 [P49802-2]
NP_002915.3, NM_002924.5 [P49802-5]
XP_005273275.1, XM_005273218.3 [P49802-1]
UniGeneiHs.655739

Genome annotation databases

EnsembliENST00000348120; ENSP00000341242; ENSG00000182901 [P49802-4]
ENST00000366563; ENSP00000355521; ENSG00000182901 [P49802-3]
ENST00000366564; ENSP00000355522; ENSG00000182901 [P49802-2]
ENST00000366565; ENSP00000355523; ENSG00000182901 [P49802-5]
GeneIDi6000
KEGGihsa:6000
UCSCiuc001hyu.4 human [P49802-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF090116 mRNA Translation: AAD34290.1
AF090117 mRNA Translation: AAD34291.1
U32439 mRNA Translation: AAC50351.1
AF493930 mRNA Translation: AAM12644.1
AF493931 mRNA Translation: AAM12645.1
AY587875 mRNA Translation: AAT52231.1
AL359764 Genomic DNA No translation available.
AL365184 Genomic DNA No translation available.
AL512307 Genomic DNA No translation available.
AL590682 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW70086.1
BC022009 mRNA Translation: AAH22009.1
CCDSiCCDS31071.1 [P49802-5]
CCDS60457.1 [P49802-4]
CCDS60458.1 [P49802-2]
CCDS60459.1 [P49802-3]
RefSeqiNP_001269702.1, NM_001282773.1 [P49802-4]
NP_001269704.1, NM_001282775.1 [P49802-3]
NP_001269707.1, NM_001282778.1 [P49802-2]
NP_002915.3, NM_002924.5 [P49802-5]
XP_005273275.1, XM_005273218.3 [P49802-1]
UniGeneiHs.655739

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A72X-ray2.00A/B320-463[»]
2D9JNMR-A323-448[»]
ProteinModelPortaliP49802
SMRiP49802
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111932, 8 interactors
DIPiDIP-40869N
IntActiP49802, 6 interactors
STRINGi9606.ENSP00000355523

Chemistry databases

BindingDBiP49802

PTM databases

iPTMnetiP49802
PhosphoSitePlusiP49802
SwissPalmiP49802

Polymorphism and mutation databases

DMDMi17380284

Proteomic databases

EPDiP49802
MaxQBiP49802
PaxDbiP49802
PeptideAtlasiP49802
PRIDEiP49802
ProteomicsDBi56134
56135 [P49802-2]
56136 [P49802-3]
56137 [P49802-4]
56138 [P49802-5]

Protocols and materials databases

DNASUi6000
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000348120; ENSP00000341242; ENSG00000182901 [P49802-4]
ENST00000366563; ENSP00000355521; ENSG00000182901 [P49802-3]
ENST00000366564; ENSP00000355522; ENSG00000182901 [P49802-2]
ENST00000366565; ENSP00000355523; ENSG00000182901 [P49802-5]
GeneIDi6000
KEGGihsa:6000
UCSCiuc001hyu.4 human [P49802-1]

Organism-specific databases

CTDi6000
DisGeNETi6000
EuPathDBiHostDB:ENSG00000182901.15
GeneCardsiRGS7
HGNCiHGNC:10003 RGS7
HPAiCAB017561
MIMi602517 gene
neXtProtiNX_P49802
OpenTargetsiENSG00000182901
PharmGKBiPA34378
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3589 Eukaryota
ENOG410YMJD LUCA
GeneTreeiENSGT00760000119142
HOVERGENiHBG007404
InParanoidiP49802
KOiK16449
OMAiSHGYLFQ
OrthoDBiEOG091G05MO
PhylomeDBiP49802
TreeFamiTF351956

Enzyme and pathway databases

ReactomeiR-HSA-418594 G alpha (i) signalling events
R-HSA-6814122 Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
SignaLinkiP49802

Miscellaneous databases

ChiTaRSiRGS7 human
EvolutionaryTraceiP49802
GeneWikiiRGS7
GenomeRNAii6000
PROiPR:P49802
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182901 Expressed in 115 organ(s), highest expression level in endothelial cell
CleanExiHS_RGS7
ExpressionAtlasiP49802 baseline and differential
GenevisibleiP49802 HS

Family and domain databases

CDDicd00068 GGL, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000591 DEP_dom
IPR015898 G-protein_gamma-like_dom
IPR036284 GGL_sf
IPR016137 RGS
IPR036305 RGS_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00610 DEP, 1 hit
PF00631 G-gamma, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR01301 RGSPROTEIN
SMARTiView protein in SMART
SM00049 DEP, 1 hit
SM00224 GGL, 1 hit
SM00315 RGS, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF48097 SSF48097, 1 hit
SSF48670 SSF48670, 1 hit
PROSITEiView protein in PROSITE
PS50186 DEP, 1 hit
PS50132 RGS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRGS7_HUMAN
AccessioniPrimary (citable) accession number: P49802
Secondary accession number(s): Q5T3H4
, Q8TD66, Q8TD67, Q8WW09, Q9UNU7, Q9Y6B9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 18, 2001
Last modified: November 7, 2018
This is version 179 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again