Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of G-protein signaling 3

Gene

RGS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionSignal transduction inhibitor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-416476 G alpha (q) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGP3
Short name:
RGS3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RGS3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000138835.22

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9999 RGS3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602189 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49796

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5998

Open Targets

More...
OpenTargetsi
ENSG00000138835

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34374

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RGS3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
67477383

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002041821 – 1198Regulator of G-protein signaling 3Add BLAST1198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei448Omega-N-methylarginineCombined sources1
Modified residuei674PhosphoserineCombined sources1
Modified residuei943PhosphoserineCombined sources1
Modified residuei946PhosphoserineBy similarity1
Modified residuei978PhosphoserineBy similarity1
Modified residuei1007PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.By similarity
ISGylated.1 Publication

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P49796

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P49796

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49796

PeptideAtlas

More...
PeptideAtlasi
P49796

PRoteomics IDEntifications database

More...
PRIDEi
P49796

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56123
56124 [P49796-1]
56125 [P49796-2]
56126 [P49796-4]
56127 [P49796-5]
56128 [P49796-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49796

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49796

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P49796

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138835 Expressed in 228 organ(s), highest expression level in left coronary artery

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49796 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49796 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB032507
HPA041109

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds EFNB1 and EFNB2 (By similarity). Binds the GNB1-GNG2 heterodimer.By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111930, 52 interactors

Protein interaction database and analysis system

More...
IntActi
P49796, 19 interactors

Molecular INTeraction database

More...
MINTi
P49796

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000259406

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F5YX-ray2.39A/B300-384[»]
2OJ4X-ray2.30A1064-1190[»]
3FBKX-ray2.00A/B134-276[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P49796

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49796

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P49796

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini137 – 239C2PROSITE-ProRule annotationAdd BLAST103
Domaini299 – 376PDZPROSITE-ProRule annotationAdd BLAST78
Domaini1073 – 1198RGSPROSITE-ProRule annotationAdd BLAST126

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi705 – 819Pro-richAdd BLAST115

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3589 Eukaryota
ENOG410YMJD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154416

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000065737

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG013233

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49796

KEGG Orthology (KO)

More...
KOi
K07524

Identification of Orthologs from Complete Genome Data

More...
OMAi
QPAGKAD

Database of Orthologous Groups

More...
OrthoDBi
201302at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49796

TreeFam database of animal gene trees

More...
TreeFami
TF351952

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08713 RGS_RGS3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.196.10, 2 hits
2.30.29.30, 1 hit
2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR016137 RGS
IPR034951 RGS_RGS3
IPR036305 RGS_sf
IPR024066 RGS_subdom1/3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 1 hit
PF00615 RGS, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01301 RGSPROTEIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 1 hit
SM00228 PDZ, 1 hit
SM00315 RGS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 1 hit
PS50106 PDZ, 1 hit
PS50132 RGS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: P49796-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVIPALWEV EMGRSQGQEI ETILANRSHS DSTPLPNFLS GSHRPECCTC
60 70 80 90 100
RLLTASGAQD SLPFGRRLYS GPWRSCEEVC HVSVLSVLST SCGLSLSLPI
110 120 130 140 150
FPGWMEWLSP DIALPRRDEW TQTSPARKRI THAKVQGAGQ LRLSIDAQDR
160 170 180 190 200
VLLLHIIEGK GLISKQPGTC DPYVKISLIP EDSRLRHQKT QTVPDCRDPA
210 220 230 240 250
FHEHFFFPVQ EEDDQKRLLV TVWNRASQSR QSGLIGCMSF GVKSLLTPDK
260 270 280 290 300
EISGWYYLLG EHLGRTKHLK VARRRLRPLR DPLLRMPGGG DTENGKKLKI
310 320 330 340 350
TIPRGKDGFG FTICCDSPVR VQAVDSGGPA ERAGLQQLDT VLQLNERPVE
360 370 380 390 400
HWKCVELAHE IRSCPSEIIL LVWRMVPQVK PGPDGGVLRR ASCKSTHDLQ
410 420 430 440 450
SPPNKREKNC THGVQARPEQ RHSCHLVCDS SDGLLLGGWE RYTEVAKRGG
460 470 480 490 500
QHTLPALSRA TAPTDPNYII LAPLNPGSQL LRPVYQEDTI PEESGSPSKG
510 520 530 540 550
KSYTGLGKKS RLMKTVQTMK GHGNYQNCPV VRPHATHSSY GTYVTLAPKV
560 570 580 590 600
LVFPVFVQPL DLCNPARTLL LSEELLLYEG RNKAAEVTLF AYSDLLLFTK
610 620 630 640 650
EDEPGRCDVL RNPLYLQSVK LQEGSSEDLK FCVLYLAEKA ECLFTLEAHS
660 670 680 690 700
QEQKKRVCWC LSENIAKQQQ LAASPPDSKM FETEADEKRE MALEEGKGPG
710 720 730 740 750
AEDSPPSKEP SPGQELPPGQ DLPPNKDSPS GQEPAPSQEP LSSKDSATSE
760 770 780 790 800
GSPPGPDAPP SKDVPPCQEP PPAQDLSPCQ DLPAGQEPLP HQDPLLTKDL
810 820 830 840 850
PAIQESPTRD LPPCQDLPPS QVSLPAKALT EDTMSSGDLL AATGDPPAAP
860 870 880 890 900
RPAFVIPEVR LDSTYSQKAG AEQGCSGDEE DAEEAEEVEE GEEGEEDEDE
910 920 930 940 950
DTSDDNYGER SEAKRSSMIE TGQGAEGGLS LRVQNSLRRR THSEGSLLQE
960 970 980 990 1000
PRGPCFASDT TLHCSDGEGA ASTWGMPSPS TLKKELGRNG GSMHHLSLFF
1010 1020 1030 1040 1050
TGHRKMSGAD TVGDDDEASR KRKSKNLAKD MKNKLGIFRR RNESPGAPPA
1060 1070 1080 1090 1100
GKADKMMKSF KPTSEEALKW GESLEKLLVH KYGLAVFQAF LRTEFSEENL
1110 1120 1130 1140 1150
EFWLACEDFK KVKSQSKMAS KAKKIFAEYI AIQACKEVNL DSYTREHTKD
1160 1170 1180 1190
NLQSVTRGCF DLAQKRIFGL MEKDSYPRFL RSDLYLDLIN QKKMSPPL
Length:1,198
Mass (Da):132,336
Last modified:June 7, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE615DA49022EFFE4
GO
Isoform 1 (identifier: P49796-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-679: Missing.

Show »
Length:519
Mass (Da):56,602
Checksum:iF1CFE3F27D4673A0
GO
Isoform 2 (identifier: P49796-2) [UniParc]FASTAAdd to basket
Also known as: RGS3T

The sequence of this isoform differs from the canonical sequence as follows:
     1-992: Missing.

Note: Nuclear.1 Publication
Show »
Length:206
Mass (Da):23,725
Checksum:iE24047B4952692D4
GO
Isoform 4 (identifier: P49796-4) [UniParc]FASTAAdd to basket
Also known as: 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ

Show »
Length:917
Mass (Da):100,948
Checksum:i17D77BE23D0A1C52
GO
Isoform 5 (identifier: P49796-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     113-138: ALPRRDEWTQTSPARKRITHAKVQGA → MERSLHRVSLGSRRAHPDLSFYLTTF
     680-714: MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQ → KLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTLIG
     715-1198: Missing.

Show »
Length:602
Mass (Da):67,282
Checksum:i1976A77C3FC3933F
GO
Isoform 6 (identifier: P49796-6) [UniParc]FASTAAdd to basket
Also known as: C2PA-RGS3

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.

Show »
Length:1,094
Mass (Da):121,008
Checksum:i9465608DAA6F95B6
GO
Isoform 7 (identifier: P49796-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE

Note: No experimental confirmation available.
Show »
Length:311
Mass (Da):35,108
Checksum:i6886A35CF3ADF13E
GO
Isoform 8 (identifier: P49796-8) [UniParc]FASTAAdd to basket
Also known as: RGS3S

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE
     1198-1198: L → LDYKDDDDK

Show »
Length:319
Mass (Da):36,103
Checksum:iB667E606719743CF
GO
Isoform 9 (identifier: P49796-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ
     679-1004: Missing.

Note: No experimental confirmation available.
Show »
Length:591
Mass (Da):66,478
Checksum:i379E2AA9DB27D837
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXY1H7BXY1_HUMAN
Regulator of G-protein signalling 3...
RGS3 hCG_29191
168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUY2A0A087WUY2_HUMAN
Regulator of G-protein-signaling 3
RGS3
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VXC0Q5VXC0_HUMAN
Regulator of G-protein-signaling 3
RGS3
340Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C539H7C539_HUMAN
Regulator of G-protein-signaling 3
RGS3
214Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J582C9J582_HUMAN
Regulator of G-protein-signaling 3
RGS3
247Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6G2C9J6G2_HUMAN
Regulator of G-protein-signaling 3
RGS3
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti170C → W in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti206F → S in BAC11328 (PubMed:14702039).Curated1
Sequence conflicti266T → A in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti462A → V in AAL68829 (Ref. 4) Curated1
Sequence conflicti585A → V in AAM33255 (PubMed:12036301).Curated1
Sequence conflicti632C → R in BAC11328 (PubMed:14702039).Curated1
Sequence conflicti705Missing in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti725N → S in AAH42555 (PubMed:15489334).Curated1
Sequence conflicti873Q → H in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti883 – 884EE → KQ in AAM33254 (PubMed:12036301).Curated2
Sequence conflicti984K → R in AAM12641 (Ref. 5) Curated1
Sequence conflicti1127A → V in AAM33253 (PubMed:12036301).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051794129R → K. Corresponds to variant dbSNP:rs16933949Ensembl.1
Natural variantiVAR_061769809R → Q. Corresponds to variant dbSNP:rs41305473Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0470291 – 1027MPVIP…KSKNL → MVTRRPVTNSWDWLPAGAAP EAVPCRHMPLSRLPLRVGQK EFFFPLPLLVPPISWLLLSE SQPRLVPGSPVIRPGFQRAC VAAACTVAARCPGRGVGDRS QSGASYRPICGPKVGGPTEM LRGMYLTRNGNLQRRHTMKE in isoform 7 and isoform 8. 1 PublicationAdd BLAST1027
Alternative sequenceiVSP_0056621 – 992Missing in isoform 2. 1 PublicationAdd BLAST992
Alternative sequenceiVSP_0139581 – 679Missing in isoform 1. 4 PublicationsAdd BLAST679
Alternative sequenceiVSP_0139591 – 281Missing in isoform 4 and isoform 9. 5 PublicationsAdd BLAST281
Alternative sequenceiVSP_0139611 – 112Missing in isoform 5. 1 PublicationAdd BLAST112
Alternative sequenceiVSP_0139601 – 104Missing in isoform 6. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_013962113 – 138ALPRR…KVQGA → MERSLHRVSLGSRRAHPDLS FYLTTF in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_013963282 – 299PLLRM…GKKLK → MNRFNGLCKVCSERRYRQ in isoform 4 and isoform 9. 5 PublicationsAdd BLAST18
Alternative sequenceiVSP_054690679 – 1004Missing in isoform 9. 1 PublicationAdd BLAST326
Alternative sequenceiVSP_013964680 – 714MFETE…PSPGQ → KLHPFGSLQQEMGPVNSTNA TQDRSFTSPGQTLIG in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_013965715 – 1198Missing in isoform 5. 1 PublicationAdd BLAST484
Alternative sequenceiVSP_0535331198L → LDYKDDDDK in isoform 8. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U27655 mRNA Translation: AAC50394.1
AF490838 mRNA Translation: AAM33253.1
AF490839 mRNA Translation: AAM33254.1
AF490840 mRNA Translation: AAM33255.1
AK074977 mRNA Translation: BAC11328.1
AK096840 mRNA Translation: BAG53374.1
AK128127 mRNA Translation: BAC87285.1
AK289666 mRNA Translation: BAF82355.1
AF493927 mRNA Translation: AAM12641.1
AF493941 mRNA Translation: AAM12655.1
AY585192 mRNA Translation: AAT79495.1
AF463495 Genomic DNA Translation: AAL68829.1
AL137066 Genomic DNA No translation available.
AL162727 Genomic DNA No translation available.
AL359455 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87388.1
CH471090 Genomic DNA Translation: EAW87391.1
CH471090 Genomic DNA Translation: EAW87393.1
BC019039 mRNA Translation: AAH19039.3
BC042555 mRNA Translation: AAH42555.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35113.1 [P49796-5]
CCDS35114.1 [P49796-7]
CCDS43869.1 [P49796-3]
CCDS65111.1 [P49796-9]
CCDS6797.1 [P49796-4]
CCDS6798.1 [P49796-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S78089

NCBI Reference Sequences

More...
RefSeqi
NP_001263189.1, NM_001276260.1 [P49796-1]
NP_001263190.1, NM_001276261.1 [P49796-9]
NP_001263191.1, NM_001276262.1
NP_001269851.1, NM_001282922.1 [P49796-1]
NP_001269852.1, NM_001282923.1
NP_060260.3, NM_017790.4 [P49796-5]
NP_570613.2, NM_130795.3 [P49796-4]
NP_602299.1, NM_134427.2
NP_652759.3, NM_144488.5 [P49796-3]
NP_652760.2, NM_144489.3 [P49796-7]
XP_006717282.1, XM_006717219.2 [P49796-6]
XP_006717289.1, XM_006717226.2 [P49796-1]
XP_006717293.1, XM_006717230.3 [P49796-1]
XP_011517198.1, XM_011518896.1 [P49796-1]
XP_011517199.1, XM_011518897.2
XP_011517200.1, XM_011518898.1 [P49796-1]
XP_011517202.1, XM_011518900.1 [P49796-1]
XP_011517203.1, XM_011518901.1 [P49796-1]
XP_016870494.1, XM_017015005.1 [P49796-1]
XP_016870495.1, XM_017015006.1 [P49796-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.494875
Hs.655276
Hs.745529

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317613; ENSP00000312844; ENSG00000138835 [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835 [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835 [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835 [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835 [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835 [P49796-9]
ENST00000462143; ENSP00000420356; ENSG00000138835 [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835 [P49796-7]
ENST00000613049; ENSP00000482612; ENSG00000138835 [P49796-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5998

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5998

UCSC genome browser

More...
UCSCi
uc004bhq.5 human [P49796-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27655 mRNA Translation: AAC50394.1
AF490838 mRNA Translation: AAM33253.1
AF490839 mRNA Translation: AAM33254.1
AF490840 mRNA Translation: AAM33255.1
AK074977 mRNA Translation: BAC11328.1
AK096840 mRNA Translation: BAG53374.1
AK128127 mRNA Translation: BAC87285.1
AK289666 mRNA Translation: BAF82355.1
AF493927 mRNA Translation: AAM12641.1
AF493941 mRNA Translation: AAM12655.1
AY585192 mRNA Translation: AAT79495.1
AF463495 Genomic DNA Translation: AAL68829.1
AL137066 Genomic DNA No translation available.
AL162727 Genomic DNA No translation available.
AL359455 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87388.1
CH471090 Genomic DNA Translation: EAW87391.1
CH471090 Genomic DNA Translation: EAW87393.1
BC019039 mRNA Translation: AAH19039.3
BC042555 mRNA Translation: AAH42555.1
CCDSiCCDS35113.1 [P49796-5]
CCDS35114.1 [P49796-7]
CCDS43869.1 [P49796-3]
CCDS65111.1 [P49796-9]
CCDS6797.1 [P49796-4]
CCDS6798.1 [P49796-1]
PIRiS78089
RefSeqiNP_001263189.1, NM_001276260.1 [P49796-1]
NP_001263190.1, NM_001276261.1 [P49796-9]
NP_001263191.1, NM_001276262.1
NP_001269851.1, NM_001282922.1 [P49796-1]
NP_001269852.1, NM_001282923.1
NP_060260.3, NM_017790.4 [P49796-5]
NP_570613.2, NM_130795.3 [P49796-4]
NP_602299.1, NM_134427.2
NP_652759.3, NM_144488.5 [P49796-3]
NP_652760.2, NM_144489.3 [P49796-7]
XP_006717282.1, XM_006717219.2 [P49796-6]
XP_006717289.1, XM_006717226.2 [P49796-1]
XP_006717293.1, XM_006717230.3 [P49796-1]
XP_011517198.1, XM_011518896.1 [P49796-1]
XP_011517199.1, XM_011518897.2
XP_011517200.1, XM_011518898.1 [P49796-1]
XP_011517202.1, XM_011518900.1 [P49796-1]
XP_011517203.1, XM_011518901.1 [P49796-1]
XP_016870494.1, XM_017015005.1 [P49796-1]
XP_016870495.1, XM_017015006.1 [P49796-1]
UniGeneiHs.494875
Hs.655276
Hs.745529

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F5YX-ray2.39A/B300-384[»]
2OJ4X-ray2.30A1064-1190[»]
3FBKX-ray2.00A/B134-276[»]
ProteinModelPortaliP49796
SMRiP49796
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111930, 52 interactors
IntActiP49796, 19 interactors
MINTiP49796
STRINGi9606.ENSP00000259406

PTM databases

iPTMnetiP49796
PhosphoSitePlusiP49796
SwissPalmiP49796

Polymorphism and mutation databases

BioMutaiRGS3
DMDMi67477383

Proteomic databases

EPDiP49796
jPOSTiP49796
PaxDbiP49796
PeptideAtlasiP49796
PRIDEiP49796
ProteomicsDBi56123
56124 [P49796-1]
56125 [P49796-2]
56126 [P49796-4]
56127 [P49796-5]
56128 [P49796-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317613; ENSP00000312844; ENSG00000138835 [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835 [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835 [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835 [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835 [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835 [P49796-9]
ENST00000462143; ENSP00000420356; ENSG00000138835 [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835 [P49796-7]
ENST00000613049; ENSP00000482612; ENSG00000138835 [P49796-7]
GeneIDi5998
KEGGihsa:5998
UCSCiuc004bhq.5 human [P49796-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5998
DisGeNETi5998
EuPathDBiHostDB:ENSG00000138835.22

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RGS3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0169384
HGNCiHGNC:9999 RGS3
HPAiCAB032507
HPA041109
MIMi602189 gene
neXtProtiNX_P49796
OpenTargetsiENSG00000138835
PharmGKBiPA34374

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3589 Eukaryota
ENOG410YMJD LUCA
GeneTreeiENSGT00940000154416
HOGENOMiHOG000065737
HOVERGENiHBG013233
InParanoidiP49796
KOiK07524
OMAiQPAGKAD
OrthoDBi201302at2759
PhylomeDBiP49796
TreeFamiTF351952

Enzyme and pathway databases

ReactomeiR-HSA-416476 G alpha (q) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RGS3 human
EvolutionaryTraceiP49796

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RGS3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5998

Protein Ontology

More...
PROi
PR:P49796

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138835 Expressed in 228 organ(s), highest expression level in left coronary artery
ExpressionAtlasiP49796 baseline and differential
GenevisibleiP49796 HS

Family and domain databases

CDDicd08713 RGS_RGS3, 1 hit
Gene3Di1.10.196.10, 2 hits
2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR016137 RGS
IPR034951 RGS_RGS3
IPR036305 RGS_sf
IPR024066 RGS_subdom1/3
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR01301 RGSPROTEIN
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00228 PDZ, 1 hit
SM00315 RGS, 1 hit
SUPFAMiSSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50106 PDZ, 1 hit
PS50132 RGS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGS3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49796
Secondary accession number(s): A6NHA0
, A8K0V1, B3KUB2, Q5VXB8, Q5VXC1, Q5VZ05, Q5VZ06, Q6ZRM5, Q8IUQ1, Q8NC47, Q8NFN4, Q8NFN5, Q8NFN6, Q8TD59, Q8TD68, Q8WV02, Q8WXA0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: January 16, 2019
This is version 196 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again