Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of G-protein signaling 3

Gene

RGS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.4 Publications

GO - Molecular functioni

  • GTPase activator activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionSignal transduction inhibitor

Enzyme and pathway databases

ReactomeiR-HSA-416476 G alpha (q) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGP3
Short name:
RGS3
Gene namesi
Name:RGS3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000138835.22
HGNCiHGNC:9999 RGS3
MIMi602189 gene
neXtProtiNX_P49796

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5998
OpenTargetsiENSG00000138835
PharmGKBiPA34374

Polymorphism and mutation databases

DMDMi67477383

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002041821 – 1198Regulator of G-protein signaling 3Add BLAST1198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei448Omega-N-methylarginineCombined sources1
Modified residuei674PhosphoserineCombined sources1
Modified residuei943PhosphoserineCombined sources1
Modified residuei946PhosphoserineBy similarity1
Modified residuei978PhosphoserineBy similarity1
Modified residuei1007PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.By similarity
ISGylated.1 Publication

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP49796
PaxDbiP49796
PeptideAtlasiP49796
PRIDEiP49796
ProteomicsDBi56123
56124 [P49796-1]
56125 [P49796-2]
56126 [P49796-4]
56127 [P49796-5]
56128 [P49796-6]

PTM databases

iPTMnetiP49796
PhosphoSitePlusiP49796
SwissPalmiP49796

Expressioni

Gene expression databases

BgeeiENSG00000138835 Expressed in 228 organ(s), highest expression level in left coronary artery
ExpressionAtlasiP49796 baseline and differential
GenevisibleiP49796 HS

Organism-specific databases

HPAiCAB032507
HPA041109

Interactioni

Subunit structurei

Binds EFNB1 and EFNB2 (By similarity). Binds the GNB1-GNG2 heterodimer.By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi111930, 52 interactors
IntActiP49796, 19 interactors
MINTiP49796
STRINGi9606.ENSP00000259406

Structurei

Secondary structure

11198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP49796
SMRiP49796
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49796

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini137 – 239C2PROSITE-ProRule annotationAdd BLAST103
Domaini299 – 376PDZPROSITE-ProRule annotationAdd BLAST78
Domaini1073 – 1198RGSPROSITE-ProRule annotationAdd BLAST126

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi705 – 819Pro-richAdd BLAST115

Phylogenomic databases

eggNOGiKOG3589 Eukaryota
ENOG410YMJD LUCA
GeneTreeiENSGT00760000118903
HOGENOMiHOG000065737
HOVERGENiHBG013233
InParanoidiP49796
KOiK07524
OMAiQPAGKAD
OrthoDBiEOG091G0BDG
PhylomeDBiP49796
TreeFamiTF351952

Family and domain databases

CDDicd08713 RGS_RGS3, 1 hit
Gene3Di1.10.196.10, 2 hits
2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR016137 RGS
IPR034951 RGS_RGS3
IPR036305 RGS_sf
IPR024066 RGS_subdom1/3
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF00595 PDZ, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR01301 RGSPROTEIN
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00228 PDZ, 1 hit
SM00315 RGS, 1 hit
SUPFAMiSSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50106 PDZ, 1 hit
PS50132 RGS, 1 hit

Sequences (9+)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: P49796-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVIPALWEV EMGRSQGQEI ETILANRSHS DSTPLPNFLS GSHRPECCTC
60 70 80 90 100
RLLTASGAQD SLPFGRRLYS GPWRSCEEVC HVSVLSVLST SCGLSLSLPI
110 120 130 140 150
FPGWMEWLSP DIALPRRDEW TQTSPARKRI THAKVQGAGQ LRLSIDAQDR
160 170 180 190 200
VLLLHIIEGK GLISKQPGTC DPYVKISLIP EDSRLRHQKT QTVPDCRDPA
210 220 230 240 250
FHEHFFFPVQ EEDDQKRLLV TVWNRASQSR QSGLIGCMSF GVKSLLTPDK
260 270 280 290 300
EISGWYYLLG EHLGRTKHLK VARRRLRPLR DPLLRMPGGG DTENGKKLKI
310 320 330 340 350
TIPRGKDGFG FTICCDSPVR VQAVDSGGPA ERAGLQQLDT VLQLNERPVE
360 370 380 390 400
HWKCVELAHE IRSCPSEIIL LVWRMVPQVK PGPDGGVLRR ASCKSTHDLQ
410 420 430 440 450
SPPNKREKNC THGVQARPEQ RHSCHLVCDS SDGLLLGGWE RYTEVAKRGG
460 470 480 490 500
QHTLPALSRA TAPTDPNYII LAPLNPGSQL LRPVYQEDTI PEESGSPSKG
510 520 530 540 550
KSYTGLGKKS RLMKTVQTMK GHGNYQNCPV VRPHATHSSY GTYVTLAPKV
560 570 580 590 600
LVFPVFVQPL DLCNPARTLL LSEELLLYEG RNKAAEVTLF AYSDLLLFTK
610 620 630 640 650
EDEPGRCDVL RNPLYLQSVK LQEGSSEDLK FCVLYLAEKA ECLFTLEAHS
660 670 680 690 700
QEQKKRVCWC LSENIAKQQQ LAASPPDSKM FETEADEKRE MALEEGKGPG
710 720 730 740 750
AEDSPPSKEP SPGQELPPGQ DLPPNKDSPS GQEPAPSQEP LSSKDSATSE
760 770 780 790 800
GSPPGPDAPP SKDVPPCQEP PPAQDLSPCQ DLPAGQEPLP HQDPLLTKDL
810 820 830 840 850
PAIQESPTRD LPPCQDLPPS QVSLPAKALT EDTMSSGDLL AATGDPPAAP
860 870 880 890 900
RPAFVIPEVR LDSTYSQKAG AEQGCSGDEE DAEEAEEVEE GEEGEEDEDE
910 920 930 940 950
DTSDDNYGER SEAKRSSMIE TGQGAEGGLS LRVQNSLRRR THSEGSLLQE
960 970 980 990 1000
PRGPCFASDT TLHCSDGEGA ASTWGMPSPS TLKKELGRNG GSMHHLSLFF
1010 1020 1030 1040 1050
TGHRKMSGAD TVGDDDEASR KRKSKNLAKD MKNKLGIFRR RNESPGAPPA
1060 1070 1080 1090 1100
GKADKMMKSF KPTSEEALKW GESLEKLLVH KYGLAVFQAF LRTEFSEENL
1110 1120 1130 1140 1150
EFWLACEDFK KVKSQSKMAS KAKKIFAEYI AIQACKEVNL DSYTREHTKD
1160 1170 1180 1190
NLQSVTRGCF DLAQKRIFGL MEKDSYPRFL RSDLYLDLIN QKKMSPPL
Length:1,198
Mass (Da):132,336
Last modified:June 7, 2005 - v2
Checksum:iE615DA49022EFFE4
GO
Isoform 1 (identifier: P49796-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-679: Missing.

Show »
Length:519
Mass (Da):56,602
Checksum:iF1CFE3F27D4673A0
GO
Isoform 2 (identifier: P49796-2) [UniParc]FASTAAdd to basket
Also known as: RGS3T

The sequence of this isoform differs from the canonical sequence as follows:
     1-992: Missing.

Note: Nuclear.1 Publication
Show »
Length:206
Mass (Da):23,725
Checksum:iE24047B4952692D4
GO
Isoform 4 (identifier: P49796-4) [UniParc]FASTAAdd to basket
Also known as: 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ

Show »
Length:917
Mass (Da):100,948
Checksum:i17D77BE23D0A1C52
GO
Isoform 5 (identifier: P49796-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     113-138: ALPRRDEWTQTSPARKRITHAKVQGA → MERSLHRVSLGSRRAHPDLSFYLTTF
     680-714: MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQ → KLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTLIG
     715-1198: Missing.

Show »
Length:602
Mass (Da):67,282
Checksum:i1976A77C3FC3933F
GO
Isoform 6 (identifier: P49796-6) [UniParc]FASTAAdd to basket
Also known as: C2PA-RGS3

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.

Show »
Length:1,094
Mass (Da):121,008
Checksum:i9465608DAA6F95B6
GO
Isoform 7 (identifier: P49796-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE

Note: No experimental confirmation available.
Show »
Length:311
Mass (Da):35,108
Checksum:i6886A35CF3ADF13E
GO
Isoform 8 (identifier: P49796-8) [UniParc]FASTAAdd to basket
Also known as: RGS3S

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE
     1198-1198: L → LDYKDDDDK

Show »
Length:319
Mass (Da):36,103
Checksum:iB667E606719743CF
GO
Isoform 9 (identifier: P49796-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ
     679-1004: Missing.

Note: No experimental confirmation available.
Show »
Length:591
Mass (Da):66,478
Checksum:i379E2AA9DB27D837
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXY1H7BXY1_HUMAN
Regulator of G-protein signalling 3...
RGS3 hCG_29191
168Annotation score:
A0A087WUY2A0A087WUY2_HUMAN
Regulator of G-protein-signaling 3
RGS3
192Annotation score:
Q5VXC0Q5VXC0_HUMAN
Regulator of G-protein-signaling 3
RGS3
340Annotation score:
H7C539H7C539_HUMAN
Regulator of G-protein-signaling 3
RGS3
214Annotation score:
C9J582C9J582_HUMAN
Regulator of G-protein-signaling 3
RGS3
247Annotation score:
C9J6G2C9J6G2_HUMAN
Regulator of G-protein-signaling 3
RGS3
74Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti170C → W in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti206F → S in BAC11328 (PubMed:14702039).Curated1
Sequence conflicti266T → A in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti462A → V in AAL68829 (Ref. 4) Curated1
Sequence conflicti585A → V in AAM33255 (PubMed:12036301).Curated1
Sequence conflicti632C → R in BAC11328 (PubMed:14702039).Curated1
Sequence conflicti705Missing in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti725N → S in AAH42555 (PubMed:15489334).Curated1
Sequence conflicti873Q → H in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti883 – 884EE → KQ in AAM33254 (PubMed:12036301).Curated2
Sequence conflicti984K → R in AAM12641 (Ref. 5) Curated1
Sequence conflicti1127A → V in AAM33253 (PubMed:12036301).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051794129R → K. Corresponds to variant dbSNP:rs16933949Ensembl.1
Natural variantiVAR_061769809R → Q. Corresponds to variant dbSNP:rs41305473Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0470291 – 1027MPVIP…KSKNL → MVTRRPVTNSWDWLPAGAAP EAVPCRHMPLSRLPLRVGQK EFFFPLPLLVPPISWLLLSE SQPRLVPGSPVIRPGFQRAC VAAACTVAARCPGRGVGDRS QSGASYRPICGPKVGGPTEM LRGMYLTRNGNLQRRHTMKE in isoform 7 and isoform 8. 1 PublicationAdd BLAST1027
Alternative sequenceiVSP_0056621 – 992Missing in isoform 2. 1 PublicationAdd BLAST992
Alternative sequenceiVSP_0139581 – 679Missing in isoform 1. 4 PublicationsAdd BLAST679
Alternative sequenceiVSP_0139591 – 281Missing in isoform 4 and isoform 9. 5 PublicationsAdd BLAST281
Alternative sequenceiVSP_0139611 – 112Missing in isoform 5. 1 PublicationAdd BLAST112
Alternative sequenceiVSP_0139601 – 104Missing in isoform 6. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_013962113 – 138ALPRR…KVQGA → MERSLHRVSLGSRRAHPDLS FYLTTF in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_013963282 – 299PLLRM…GKKLK → MNRFNGLCKVCSERRYRQ in isoform 4 and isoform 9. 5 PublicationsAdd BLAST18
Alternative sequenceiVSP_054690679 – 1004Missing in isoform 9. 1 PublicationAdd BLAST326
Alternative sequenceiVSP_013964680 – 714MFETE…PSPGQ → KLHPFGSLQQEMGPVNSTNA TQDRSFTSPGQTLIG in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_013965715 – 1198Missing in isoform 5. 1 PublicationAdd BLAST484
Alternative sequenceiVSP_0535331198L → LDYKDDDDK in isoform 8. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27655 mRNA Translation: AAC50394.1
AF490838 mRNA Translation: AAM33253.1
AF490839 mRNA Translation: AAM33254.1
AF490840 mRNA Translation: AAM33255.1
AK074977 mRNA Translation: BAC11328.1
AK096840 mRNA Translation: BAG53374.1
AK128127 mRNA Translation: BAC87285.1
AK289666 mRNA Translation: BAF82355.1
AF493927 mRNA Translation: AAM12641.1
AF493941 mRNA Translation: AAM12655.1
AY585192 mRNA Translation: AAT79495.1
AF463495 Genomic DNA Translation: AAL68829.1
AL137066 Genomic DNA No translation available.
AL162727 Genomic DNA No translation available.
AL359455 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87388.1
CH471090 Genomic DNA Translation: EAW87391.1
CH471090 Genomic DNA Translation: EAW87393.1
BC019039 mRNA Translation: AAH19039.3
BC042555 mRNA Translation: AAH42555.1
CCDSiCCDS35113.1 [P49796-5]
CCDS35114.1 [P49796-7]
CCDS43869.1 [P49796-3]
CCDS65111.1 [P49796-9]
CCDS6797.1 [P49796-4]
CCDS6798.1 [P49796-1]
PIRiS78089
RefSeqiNP_001263189.1, NM_001276260.1 [P49796-1]
NP_001263190.1, NM_001276261.1 [P49796-9]
NP_001263191.1, NM_001276262.1
NP_001269851.1, NM_001282922.1 [P49796-1]
NP_001269852.1, NM_001282923.1
NP_060260.3, NM_017790.4 [P49796-5]
NP_570613.2, NM_130795.3 [P49796-4]
NP_602299.1, NM_134427.2
NP_652759.3, NM_144488.5 [P49796-3]
NP_652760.2, NM_144489.3 [P49796-7]
XP_006717282.1, XM_006717219.2 [P49796-6]
XP_006717289.1, XM_006717226.2 [P49796-1]
XP_006717293.1, XM_006717230.3 [P49796-1]
XP_011517198.1, XM_011518896.1 [P49796-1]
XP_011517199.1, XM_011518897.2
XP_011517200.1, XM_011518898.1 [P49796-1]
XP_011517202.1, XM_011518900.1 [P49796-1]
XP_011517203.1, XM_011518901.1 [P49796-1]
XP_016870494.1, XM_017015005.1 [P49796-1]
XP_016870495.1, XM_017015006.1 [P49796-1]
UniGeneiHs.494875
Hs.655276
Hs.745529

Genome annotation databases

EnsembliENST00000317613; ENSP00000312844; ENSG00000138835 [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835 [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835 [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835 [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835 [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835 [P49796-9]
ENST00000462143; ENSP00000420356; ENSG00000138835 [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835 [P49796-7]
ENST00000613049; ENSP00000482612; ENSG00000138835 [P49796-7]
GeneIDi5998
KEGGihsa:5998
UCSCiuc004bhq.5 human [P49796-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27655 mRNA Translation: AAC50394.1
AF490838 mRNA Translation: AAM33253.1
AF490839 mRNA Translation: AAM33254.1
AF490840 mRNA Translation: AAM33255.1
AK074977 mRNA Translation: BAC11328.1
AK096840 mRNA Translation: BAG53374.1
AK128127 mRNA Translation: BAC87285.1
AK289666 mRNA Translation: BAF82355.1
AF493927 mRNA Translation: AAM12641.1
AF493941 mRNA Translation: AAM12655.1
AY585192 mRNA Translation: AAT79495.1
AF463495 Genomic DNA Translation: AAL68829.1
AL137066 Genomic DNA No translation available.
AL162727 Genomic DNA No translation available.
AL359455 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87388.1
CH471090 Genomic DNA Translation: EAW87391.1
CH471090 Genomic DNA Translation: EAW87393.1
BC019039 mRNA Translation: AAH19039.3
BC042555 mRNA Translation: AAH42555.1
CCDSiCCDS35113.1 [P49796-5]
CCDS35114.1 [P49796-7]
CCDS43869.1 [P49796-3]
CCDS65111.1 [P49796-9]
CCDS6797.1 [P49796-4]
CCDS6798.1 [P49796-1]
PIRiS78089
RefSeqiNP_001263189.1, NM_001276260.1 [P49796-1]
NP_001263190.1, NM_001276261.1 [P49796-9]
NP_001263191.1, NM_001276262.1
NP_001269851.1, NM_001282922.1 [P49796-1]
NP_001269852.1, NM_001282923.1
NP_060260.3, NM_017790.4 [P49796-5]
NP_570613.2, NM_130795.3 [P49796-4]
NP_602299.1, NM_134427.2
NP_652759.3, NM_144488.5 [P49796-3]
NP_652760.2, NM_144489.3 [P49796-7]
XP_006717282.1, XM_006717219.2 [P49796-6]
XP_006717289.1, XM_006717226.2 [P49796-1]
XP_006717293.1, XM_006717230.3 [P49796-1]
XP_011517198.1, XM_011518896.1 [P49796-1]
XP_011517199.1, XM_011518897.2
XP_011517200.1, XM_011518898.1 [P49796-1]
XP_011517202.1, XM_011518900.1 [P49796-1]
XP_011517203.1, XM_011518901.1 [P49796-1]
XP_016870494.1, XM_017015005.1 [P49796-1]
XP_016870495.1, XM_017015006.1 [P49796-1]
UniGeneiHs.494875
Hs.655276
Hs.745529

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F5YX-ray2.39A/B300-384[»]
2OJ4X-ray2.30A1064-1190[»]
3FBKX-ray2.00A/B134-276[»]
ProteinModelPortaliP49796
SMRiP49796
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111930, 52 interactors
IntActiP49796, 19 interactors
MINTiP49796
STRINGi9606.ENSP00000259406

PTM databases

iPTMnetiP49796
PhosphoSitePlusiP49796
SwissPalmiP49796

Polymorphism and mutation databases

DMDMi67477383

Proteomic databases

EPDiP49796
PaxDbiP49796
PeptideAtlasiP49796
PRIDEiP49796
ProteomicsDBi56123
56124 [P49796-1]
56125 [P49796-2]
56126 [P49796-4]
56127 [P49796-5]
56128 [P49796-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317613; ENSP00000312844; ENSG00000138835 [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835 [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835 [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835 [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835 [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835 [P49796-9]
ENST00000462143; ENSP00000420356; ENSG00000138835 [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835 [P49796-7]
ENST00000613049; ENSP00000482612; ENSG00000138835 [P49796-7]
GeneIDi5998
KEGGihsa:5998
UCSCiuc004bhq.5 human [P49796-3]

Organism-specific databases

CTDi5998
DisGeNETi5998
EuPathDBiHostDB:ENSG00000138835.22
GeneCardsiRGS3
H-InvDBiHIX0169384
HGNCiHGNC:9999 RGS3
HPAiCAB032507
HPA041109
MIMi602189 gene
neXtProtiNX_P49796
OpenTargetsiENSG00000138835
PharmGKBiPA34374
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3589 Eukaryota
ENOG410YMJD LUCA
GeneTreeiENSGT00760000118903
HOGENOMiHOG000065737
HOVERGENiHBG013233
InParanoidiP49796
KOiK07524
OMAiQPAGKAD
OrthoDBiEOG091G0BDG
PhylomeDBiP49796
TreeFamiTF351952

Enzyme and pathway databases

ReactomeiR-HSA-416476 G alpha (q) signalling events

Miscellaneous databases

ChiTaRSiRGS3 human
EvolutionaryTraceiP49796
GeneWikiiRGS3
GenomeRNAii5998
PROiPR:P49796
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138835 Expressed in 228 organ(s), highest expression level in left coronary artery
ExpressionAtlasiP49796 baseline and differential
GenevisibleiP49796 HS

Family and domain databases

CDDicd08713 RGS_RGS3, 1 hit
Gene3Di1.10.196.10, 2 hits
2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR016137 RGS
IPR034951 RGS_RGS3
IPR036305 RGS_sf
IPR024066 RGS_subdom1/3
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF00595 PDZ, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR01301 RGSPROTEIN
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00228 PDZ, 1 hit
SM00315 RGS, 1 hit
SUPFAMiSSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50106 PDZ, 1 hit
PS50132 RGS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRGS3_HUMAN
AccessioniPrimary (citable) accession number: P49796
Secondary accession number(s): A6NHA0
, A8K0V1, B3KUB2, Q5VXB8, Q5VXC1, Q5VZ05, Q5VZ06, Q6ZRM5, Q8IUQ1, Q8NC47, Q8NFN4, Q8NFN5, Q8NFN6, Q8TD59, Q8TD68, Q8WV02, Q8WXA0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: October 10, 2018
This is version 193 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again