Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Very long-chain specific acyl-CoA dehydrogenase, mitochondrial

Gene

ACADVL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Active toward esters of long-chain and very long chain fatty acids such as palmitoyl-CoA, myristoyl-CoA and stearoyl-CoA. Can accommodate substrate acyl chain lengths as long as 24 carbons, but shows little activity for substrates of less than 12 carbons.1 Publication

Miscellaneous

A number of straight-chain acyl-CoA dehydrogenases of different substrate specificities are present in mammalian tissues.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FAD1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: mitochondrial fatty acid beta-oxidation

This protein is involved in the pathway mitochondrial fatty acid beta-oxidation, which is part of Lipid metabolism.
View all proteins of this organism that are known to be involved in the pathway mitochondrial fatty acid beta-oxidation and in Lipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei223Substrate; via carbonyl oxygenBy similarity1
Binding sitei366FADBy similarity1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei462Proton acceptor1 Publication1
Binding sitei463Substrate; via amide nitrogenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi214 – 223FAD10
Nucleotide bindingi249 – 251FAD3
Nucleotide bindingi435 – 439FADBy similarity5
Nucleotide bindingi464 – 466FAD3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processFatty acid metabolism, Lipid metabolism
LigandFAD, Flavoprotein

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:ENSG00000072778-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.3.8.8 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-77305 Beta oxidation of palmitoyl-CoA to myristoyl-CoA

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00660

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001330 [P49748-2]
SLP:000001332

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (EC:1.3.8.9)
Short name:
VLCAD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACADVL
Synonyms:VLCAD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000072778.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:92 ACADVL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609575 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49748

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Acyl-CoA dehydrogenase very long-chain deficiency (ACADVLD)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn inborn error of mitochondrial fatty acid beta-oxidation which leads to impaired long-chain fatty acid beta-oxidation. It is clinically heterogeneous, with three major phenotypes: a severe childhood form characterized by early onset, high mortality and high incidence of cardiomyopathy; a milder childhood form with later onset, characterized by hypoketotic hypoglycemia, low mortality and rare cardiomyopathy; an adult form, with isolated skeletal muscle involvement, rhabdomyolysis and myoglobinuria, usually triggered by exercise or fasting.
See also OMIM:201475
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_000331130Missing in ACADVLD. 2 Publications1
Natural variantiVAR_000332158T → N in ACADVLD. 1
Natural variantiVAR_000333159Q → R in ACADVLD. Corresponds to variant dbSNP:rs746688190Ensembl.1
Natural variantiVAR_000334174V → M in ACADVLD. Corresponds to variant dbSNP:rs369560930EnsemblClinVar.1
Natural variantiVAR_000335185G → S in ACADVLD. Corresponds to variant dbSNP:rs545215807EnsemblClinVar.1
Natural variantiVAR_010101213A → P in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs140629318EnsemblClinVar.1
Natural variantiVAR_000336218E → K in ACADVLD. 1
Natural variantiVAR_000337243L → R in ACADVLD. 1
Natural variantiVAR_010102247K → E in ACADVLD. 1 Publication1
Natural variantiVAR_000338247K → T in ACADVLD. 1
Natural variantiVAR_000339260T → M in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs113994168EnsemblClinVar.1
Natural variantiVAR_000340278Missing in ACADVLD. 1 Publication1
Natural variantiVAR_000341281A → D in ACADVLD. 1
Natural variantiVAR_000342283V → A in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs113994167EnsemblClinVar.1
Natural variantiVAR_000343290G → D in ACADVLD. Corresponds to variant dbSNP:rs866464446Ensembl.1
Natural variantiVAR_000344294G → E in ACADVLD. Corresponds to variant dbSNP:rs200573371EnsemblClinVar.1
Natural variantiVAR_000345299K → N in ACADVLD. Corresponds to variant dbSNP:rs774716484Ensembl.1
Natural variantiVAR_000346299Missing in ACADVLD. 1 Publication1
Natural variantiVAR_000347317V → A in ACADVLD. Corresponds to variant dbSNP:rs398123095Ensembl.1
Natural variantiVAR_000348352M → V in ACADVLD. 1
Natural variantiVAR_000349366R → C in ACADVLD. Corresponds to variant dbSNP:rs771874163EnsemblClinVar.1
Natural variantiVAR_000350366R → H in ACADVLD. Corresponds to variant dbSNP:rs112406105EnsemblClinVar.1
Natural variantiVAR_000351381Missing in ACADVLD. 1
Natural variantiVAR_000352382K → Q in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs118204015EnsemblClinVar.1
Natural variantiVAR_000353405D → H in ACADVLD. 1
Natural variantiVAR_000354441G → D in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs2309689EnsemblClinVar.1
Natural variantiVAR_000355450R → H in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs118204016EnsemblClinVar.1
Natural variantiVAR_000356453R → Q in ACADVLD. Corresponds to variant dbSNP:rs138058572Ensembl.1
Natural variantiVAR_000357454D → N in ACADVLD. 1
Natural variantiVAR_000358456R → H in ACADVLD. Corresponds to variant dbSNP:rs794727112EnsemblClinVar.1
Natural variantiVAR_010103458F → L in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs118204017EnsemblClinVar.1
Natural variantiVAR_000359459R → W in ACADVLD. Corresponds to variant dbSNP:rs766742117Ensembl.1
Natural variantiVAR_000360463G → E in ACADVLD. Corresponds to variant dbSNP:rs200366828EnsemblClinVar.1
Natural variantiVAR_000361469R → Q in ACADVLD. Corresponds to variant dbSNP:rs398123083EnsemblClinVar.1
Natural variantiVAR_000362469R → W in ACADVLD. Corresponds to variant dbSNP:rs113994170EnsemblClinVar.1
Natural variantiVAR_010104490A → P in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs759775666EnsemblClinVar.1
Natural variantiVAR_000363502L → P in ACADVLD. 1
Natural variantiVAR_010105534E → K in ACADVLD; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs2230180EnsemblClinVar.1
Natural variantiVAR_000364602L → I in ACADVLD. 1
Natural variantiVAR_000365613R → W in ACADVLD. 2 PublicationsCorresponds to variant dbSNP:rs118204014EnsemblClinVar.1
Natural variantiVAR_010106615R → Q in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs148584617EnsemblClinVar.1

Keywords - Diseasei

Cardiomyopathy, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
37

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
ACADVL

MalaCards human disease database

More...
MalaCardsi
ACADVL
MIMi201475 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000072778

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
26793 Very long chain acyl-CoA dehydrogenase deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24428

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ACADVL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1703068

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 40MitochondrionCombined sourcesAdd BLAST40
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000051541 – 655Very long-chain specific acyl-CoA dehydrogenase, mitochondrialAdd BLAST615

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei51N6-acetyllysineBy similarity1
Modified residuei71N6-acetyllysine; alternateBy similarity1
Modified residuei71N6-succinyllysine; alternateBy similarity1
Modified residuei195N6-succinyllysineBy similarity1
Modified residuei237S-nitrosocysteineBy similarity1
Modified residuei239N6-acetyllysine; alternateCombined sources1
Modified residuei239N6-succinyllysine; alternateBy similarity1
Modified residuei276N6-acetyllysine; alternateBy similarity1
Modified residuei276N6-succinyllysine; alternateBy similarity1
Modified residuei278N6-acetyllysine; alternateBy similarity1
Modified residuei278N6-succinyllysine; alternateBy similarity1
Modified residuei298N6-acetyllysineBy similarity1
Modified residuei331N6-acetyllysine; alternateCombined sources1
Modified residuei331N6-succinyllysine; alternateBy similarity1
Modified residuei372N6-succinyllysineBy similarity1
Modified residuei482N6-acetyllysine; alternateBy similarity1
Modified residuei482N6-succinyllysine; alternateBy similarity1
Modified residuei517PhosphoserineCombined sources1
Modified residuei522PhosphoserineCombined sources1
Modified residuei550N6-acetyllysineBy similarity1
Modified residuei556N6-acetyllysine; alternateBy similarity1
Modified residuei556N6-succinyllysine; alternateBy similarity1
Modified residuei639N6-succinyllysineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

S-nitrosylation at Cys-237 in liver improves catalytic efficiency.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein, S-nitrosylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P49748

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P49748

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49748

PeptideAtlas

More...
PeptideAtlasi
P49748

PRoteomics IDEntifications database

More...
PRIDEi
P49748

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56061
56062 [P49748-2]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
P49748

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49748

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49748

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P49748

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000072778 Expressed in 237 organ(s), highest expression level in left lobe of thyroid gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_ACADVL

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49748 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49748 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019006
HPA020595

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106555, 45 interactors

Protein interaction database and analysis system

More...
IntActi
P49748, 22 interactors

Molecular INTeraction database

More...
MINTi
P49748

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000349297

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1655
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P49748

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49748

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P49748

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni41 – 482CatalyticAdd BLAST442
Regioni338 – 341Substrate bindingBy similarity4
Regioni462 – 463Substrate binding2
Regioni483 – 516Membrane-anchoringCuratedAdd BLAST34

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the acyl-CoA dehydrogenase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0137 Eukaryota
COG1960 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158535

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000131665

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050448

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49748

KEGG Orthology (KO)

More...
KOi
K09479

Identification of Orthologs from Complete Genome Data

More...
OMAi
NAFMGLR

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04BS

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49748

TreeFam database of animal gene trees

More...
TreeFami
TF105053

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.540.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006089 Acyl-CoA_DH_CS
IPR006091 Acyl-CoA_Oxase/DH_cen-dom
IPR036250 AcylCo_DH-like_C
IPR009075 AcylCo_DH/oxidase_C
IPR013786 AcylCoA_DH/ox_N
IPR037069 AcylCoA_DH/ox_N_sf
IPR009100 AcylCoA_DH/oxidase_NM_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00441 Acyl-CoA_dh_1, 1 hit
PF02770 Acyl-CoA_dh_M, 1 hit
PF02771 Acyl-CoA_dh_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47203 SSF47203, 1 hit
SSF56645 SSF56645, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00072 ACYL_COA_DH_1, 1 hit
PS00073 ACYL_COA_DH_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P49748-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAARMAASL GRQLLRLGGG SSRLTALLGQ PRPGPARRPY AGGAAQLALD
60 70 80 90 100
KSDSHPSDAL TRKKPAKAES KSFAVGMFKG QLTTDQVFPY PSVLNEEQTQ
110 120 130 140 150
FLKELVEPVS RFFEEVNDPA KNDALEMVEE TTWQGLKELG AFGLQVPSEL
160 170 180 190 200
GGVGLCNTQY ARLVEIVGMH DLGVGITLGA HQSIGFKGIL LFGTKAQKEK
210 220 230 240 250
YLPKLASGET VAAFCLTEPS SGSDAASIRT SAVPSPCGKY YTLNGSKLWI
260 270 280 290 300
SNGGLADIFT VFAKTPVTDP ATGAVKEKIT AFVVERGFGG ITHGPPEKKM
310 320 330 340 350
GIKASNTAEV FFDGVRVPSE NVLGEVGSGF KVAMHILNNG RFGMAAALAG
360 370 380 390 400
TMRGIIAKAV DHATNRTQFG EKIHNFGLIQ EKLARMVMLQ YVTESMAYMV
410 420 430 440 450
SANMDQGATD FQIEAAISKI FGSEAAWKVT DECIQIMGGM GFMKEPGVER
460 470 480 490 500
VLRDLRIFRI FEGTNDILRL FVALQGCMDK GKELSGLGSA LKNPFGNAGL
510 520 530 540 550
LLGEAGKQLR RRAGLGSGLS LSGLVHPELS RSGELAVRAL EQFATVVEAK
560 570 580 590 600
LIKHKKGIVN EQFLLQRLAD GAIDLYAMVV VLSRASRSLS EGHPTAQHEK
610 620 630 640 650
MLCDTWCIEA AARIREGMAA LQSDPWQQEL YRNFKSISKA LVERGGVVTS

NPLGF
Length:655
Mass (Da):70,390
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA5594D1EA7911D19
GO
Isoform 2 (identifier: P49748-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-68: Missing.

Note: No experimental confirmation available.
Show »
Length:633
Mass (Da):68,058
Checksum:iD84E8F01DF1E8958
GO
Isoform 3 (identifier: P49748-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MQAARMAASLGRQLLRLGGG → MLGGLAAAAGTRIMGKEIEAEAQRPLRQTWRPGQPPAMTAKTM

Note: No experimental confirmation available.
Show »
Length:678
Mass (Da):72,927
Checksum:i65A9CFB675A59E94
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KS89J3KS89_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQP4K7EQP4_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QKU9J3QKU9_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJW8K7EJW8_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSR4J3KSR4_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRJ8J3QRJ8_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V1M7G3V1M7_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
282Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMF8K7EMF8_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J9JID6J9JID6_HUMAN
Very long-chain-specific acyl-CoA d...
ACADVL
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti193G → C in BAA29057 (PubMed:8554625).Curated1
Sequence conflicti200K → E in BAG57027 (PubMed:14702039).Curated1
Sequence conflicti541E → K in BAG57027 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02928617L → F. Corresponds to variant dbSNP:rs2230179EnsemblClinVar.1
Natural variantiVAR_00033043G → D. Corresponds to variant dbSNP:rs2230178EnsemblClinVar.1
Natural variantiVAR_04817665P → L. Corresponds to variant dbSNP:rs28934585EnsemblClinVar.1
Natural variantiVAR_000331130Missing in ACADVLD. 2 Publications1
Natural variantiVAR_000332158T → N in ACADVLD. 1
Natural variantiVAR_000333159Q → R in ACADVLD. Corresponds to variant dbSNP:rs746688190Ensembl.1
Natural variantiVAR_000334174V → M in ACADVLD. Corresponds to variant dbSNP:rs369560930EnsemblClinVar.1
Natural variantiVAR_000335185G → S in ACADVLD. Corresponds to variant dbSNP:rs545215807EnsemblClinVar.1
Natural variantiVAR_010101213A → P in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs140629318EnsemblClinVar.1
Natural variantiVAR_000336218E → K in ACADVLD. 1
Natural variantiVAR_000337243L → R in ACADVLD. 1
Natural variantiVAR_010102247K → E in ACADVLD. 1 Publication1
Natural variantiVAR_000338247K → T in ACADVLD. 1
Natural variantiVAR_000339260T → M in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs113994168EnsemblClinVar.1
Natural variantiVAR_000340278Missing in ACADVLD. 1 Publication1
Natural variantiVAR_000341281A → D in ACADVLD. 1
Natural variantiVAR_000342283V → A in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs113994167EnsemblClinVar.1
Natural variantiVAR_000343290G → D in ACADVLD. Corresponds to variant dbSNP:rs866464446Ensembl.1
Natural variantiVAR_000344294G → E in ACADVLD. Corresponds to variant dbSNP:rs200573371EnsemblClinVar.1
Natural variantiVAR_000345299K → N in ACADVLD. Corresponds to variant dbSNP:rs774716484Ensembl.1
Natural variantiVAR_000346299Missing in ACADVLD. 1 Publication1
Natural variantiVAR_000347317V → A in ACADVLD. Corresponds to variant dbSNP:rs398123095Ensembl.1
Natural variantiVAR_000348352M → V in ACADVLD. 1
Natural variantiVAR_011990359A → S. Corresponds to variant dbSNP:rs1051701Ensembl.1
Natural variantiVAR_000349366R → C in ACADVLD. Corresponds to variant dbSNP:rs771874163EnsemblClinVar.1
Natural variantiVAR_000350366R → H in ACADVLD. Corresponds to variant dbSNP:rs112406105EnsemblClinVar.1
Natural variantiVAR_000351381Missing in ACADVLD. 1
Natural variantiVAR_000352382K → Q in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs118204015EnsemblClinVar.1
Natural variantiVAR_000353405D → H in ACADVLD. 1
Natural variantiVAR_000354441G → D in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs2309689EnsemblClinVar.1
Natural variantiVAR_000355450R → H in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs118204016EnsemblClinVar.1
Natural variantiVAR_000356453R → Q in ACADVLD. Corresponds to variant dbSNP:rs138058572Ensembl.1
Natural variantiVAR_000357454D → N in ACADVLD. 1
Natural variantiVAR_000358456R → H in ACADVLD. Corresponds to variant dbSNP:rs794727112EnsemblClinVar.1
Natural variantiVAR_010103458F → L in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs118204017EnsemblClinVar.1
Natural variantiVAR_000359459R → W in ACADVLD. Corresponds to variant dbSNP:rs766742117Ensembl.1
Natural variantiVAR_000360463G → E in ACADVLD. Corresponds to variant dbSNP:rs200366828EnsemblClinVar.1
Natural variantiVAR_000361469R → Q in ACADVLD. Corresponds to variant dbSNP:rs398123083EnsemblClinVar.1
Natural variantiVAR_000362469R → W in ACADVLD. Corresponds to variant dbSNP:rs113994170EnsemblClinVar.1
Natural variantiVAR_010104490A → P in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs759775666EnsemblClinVar.1
Natural variantiVAR_000363502L → P in ACADVLD. 1
Natural variantiVAR_010105534E → K in ACADVLD; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs2230180EnsemblClinVar.1
Natural variantiVAR_000364602L → I in ACADVLD. 1
Natural variantiVAR_000365613R → W in ACADVLD. 2 PublicationsCorresponds to variant dbSNP:rs118204014EnsemblClinVar.1
Natural variantiVAR_010106615R → Q in ACADVLD. 1 PublicationCorresponds to variant dbSNP:rs148584617EnsemblClinVar.1
Natural variantiVAR_011991623S → F. Corresponds to variant dbSNP:rs13383Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0460311 – 20MQAAR…RLGGG → MLGGLAAAAGTRIMGKEIEA EAQRPLRQTWRPGQPPAMTA KTM in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_00773447 – 68Missing in isoform 2. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D43682 mRNA Translation: BAA07781.1
L46590 Genomic DNA Translation: AAA79002.1
X86556 mRNA Translation: CAA60253.1
D78298 Genomic DNA Translation: BAA29057.1
AK293549 mRNA Translation: BAG57027.1
AC120057 Genomic DNA No translation available.
BC000399 mRNA Translation: AAH00399.1
BC012912 mRNA Translation: AAH12912.1
BC020218 mRNA Translation: AAH20218.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11090.1 [P49748-1]
CCDS42249.1 [P49748-2]
CCDS58509.1 [P49748-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
S54183

NCBI Reference Sequences

More...
RefSeqi
NP_000009.1, NM_000018.3 [P49748-1]
NP_001029031.1, NM_001033859.2 [P49748-2]
NP_001257376.1, NM_001270447.1 [P49748-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.437178

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000350303; ENSP00000344152; ENSG00000072778 [P49748-2]
ENST00000356839; ENSP00000349297; ENSG00000072778 [P49748-1]
ENST00000543245; ENSP00000438689; ENSG00000072778 [P49748-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
37

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:37

UCSC genome browser

More...
UCSCi
uc002gev.5 human [P49748-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D43682 mRNA Translation: BAA07781.1
L46590 Genomic DNA Translation: AAA79002.1
X86556 mRNA Translation: CAA60253.1
D78298 Genomic DNA Translation: BAA29057.1
AK293549 mRNA Translation: BAG57027.1
AC120057 Genomic DNA No translation available.
BC000399 mRNA Translation: AAH00399.1
BC012912 mRNA Translation: AAH12912.1
BC020218 mRNA Translation: AAH20218.1
CCDSiCCDS11090.1 [P49748-1]
CCDS42249.1 [P49748-2]
CCDS58509.1 [P49748-3]
PIRiS54183
RefSeqiNP_000009.1, NM_000018.3 [P49748-1]
NP_001029031.1, NM_001033859.2 [P49748-2]
NP_001257376.1, NM_001270447.1 [P49748-3]
UniGeneiHs.437178

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2UXWX-ray1.45A72-655[»]
3B96X-ray1.91A69-655[»]
ProteinModelPortaliP49748
SMRiP49748
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106555, 45 interactors
IntActiP49748, 22 interactors
MINTiP49748
STRINGi9606.ENSP00000349297

Chemistry databases

SwissLipidsiSLP:000001330 [P49748-2]
SLP:000001332

PTM databases

CarbonylDBiP49748
iPTMnetiP49748
PhosphoSitePlusiP49748
SwissPalmiP49748

Polymorphism and mutation databases

BioMutaiACADVL
DMDMi1703068

Proteomic databases

EPDiP49748
MaxQBiP49748
PaxDbiP49748
PeptideAtlasiP49748
PRIDEiP49748
ProteomicsDBi56061
56062 [P49748-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000350303; ENSP00000344152; ENSG00000072778 [P49748-2]
ENST00000356839; ENSP00000349297; ENSG00000072778 [P49748-1]
ENST00000543245; ENSP00000438689; ENSG00000072778 [P49748-3]
GeneIDi37
KEGGihsa:37
UCSCiuc002gev.5 human [P49748-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
37
DisGeNETi37
EuPathDBiHostDB:ENSG00000072778.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ACADVL
GeneReviewsiACADVL
HGNCiHGNC:92 ACADVL
HPAiHPA019006
HPA020595
MalaCardsiACADVL
MIMi201475 phenotype
609575 gene
neXtProtiNX_P49748
OpenTargetsiENSG00000072778
Orphaneti26793 Very long chain acyl-CoA dehydrogenase deficiency
PharmGKBiPA24428

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0137 Eukaryota
COG1960 LUCA
GeneTreeiENSGT00940000158535
HOGENOMiHOG000131665
HOVERGENiHBG050448
InParanoidiP49748
KOiK09479
OMAiNAFMGLR
OrthoDBiEOG091G04BS
PhylomeDBiP49748
TreeFamiTF105053

Enzyme and pathway databases

UniPathwayi
UPA00660

BioCyciMetaCyc:ENSG00000072778-MONOMER
BRENDAi1.3.8.8 2681
ReactomeiR-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-77305 Beta oxidation of palmitoyl-CoA to myristoyl-CoA

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ACADVL human
EvolutionaryTraceiP49748

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
37

Protein Ontology

More...
PROi
PR:P49748

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000072778 Expressed in 237 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_ACADVL
ExpressionAtlasiP49748 baseline and differential
GenevisibleiP49748 HS

Family and domain databases

Gene3Di1.10.540.10, 1 hit
InterProiView protein in InterPro
IPR006089 Acyl-CoA_DH_CS
IPR006091 Acyl-CoA_Oxase/DH_cen-dom
IPR036250 AcylCo_DH-like_C
IPR009075 AcylCo_DH/oxidase_C
IPR013786 AcylCoA_DH/ox_N
IPR037069 AcylCoA_DH/ox_N_sf
IPR009100 AcylCoA_DH/oxidase_NM_dom
PfamiView protein in Pfam
PF00441 Acyl-CoA_dh_1, 1 hit
PF02770 Acyl-CoA_dh_M, 1 hit
PF02771 Acyl-CoA_dh_N, 1 hit
SUPFAMiSSF47203 SSF47203, 1 hit
SSF56645 SSF56645, 1 hit
PROSITEiView protein in PROSITE
PS00072 ACYL_COA_DH_1, 1 hit
PS00073 ACYL_COA_DH_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACADV_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49748
Secondary accession number(s): B4DEB6
, F5H2A9, O76056, Q8WUL0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: December 5, 2018
This is version 193 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again