Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-X-C chemokine receptor type 3

Gene

CXCR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 1: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway (PubMed:12782716). Binds to CCL21. Probably promotes cell chemotaxis response.1 Publication
Isoform 2: Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway (PubMed:12782716). Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.1 Publication
Isoform 3: Mediates the activity of CXCL11.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • C-C chemokine binding Source: GO_Central
  • C-C chemokine receptor activity Source: GO_Central
  • chemokine binding Source: BHF-UCL
  • chemokine receptor activity Source: ProtInc
  • C-X-C chemokine binding Source: UniProtKB
  • C-X-C chemokine receptor activity Source: Ensembl
  • signaling receptor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
Biological processAngiogenesis, Apoptosis, Chemotaxis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-380108 Chemokine receptors bind chemokines
R-HSA-418594 G alpha (i) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-X-C chemokine receptor type 3
Short name:
CXC-R3
Short name:
CXCR-3
Alternative name(s):
CKR-L2
G protein-coupled receptor 9
Interferon-inducible protein 10 receptor
Short name:
IP-10 receptor
CD_antigen: CD183
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CXCR3
Synonyms:GPR9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000186810.7

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4540 CXCR3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300574 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49682

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 53ExtracellularSequence analysisAdd BLAST53
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei54 – 80Helical; Name=1Sequence analysisAdd BLAST27
Topological domaini81 – 89CytoplasmicSequence analysis9
Transmembranei90 – 110Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini111 – 125ExtracellularSequence analysisAdd BLAST15
Transmembranei126 – 147Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini148 – 169CytoplasmicSequence analysisAdd BLAST22
Transmembranei170 – 189Helical; Name=4Sequence analysisAdd BLAST20
Topological domaini190 – 212ExtracellularSequence analysisAdd BLAST23
Transmembranei213 – 233Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini234 – 255CytoplasmicSequence analysisAdd BLAST22
Transmembranei256 – 277Helical; Name=6Sequence analysisAdd BLAST22
Topological domaini278 – 298ExtracellularSequence analysisAdd BLAST21
Transmembranei299 – 321Helical; Name=7Sequence analysisAdd BLAST23
Topological domaini322 – 368CytoplasmicSequence analysisAdd BLAST47

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1 – 16Missing : Reduces binding to CXCL10 and CXCL11, and reduces CXCL10- and CXCL11-induced chemotaxis and activation. Does not affect CXCL9-induced chemotaxis and activation. 1 PublicationAdd BLAST16
Mutagenesisi4E → K: Does not affect binding to CXCL9, CXCL10 and CXCL11 or activation. 1 Publication1
Mutagenesisi21E → K: Reduces slightly CXCL9-, CXCL10- and CXCL11-induced chemotaxis. 1 Publication1
Mutagenesisi27 – 29YDY → ADA: Abolishes binding to CXCL10 and CXCL11 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. 1 Publication3
Mutagenesisi27Y → F: Reduces sulfation and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. Abolishes binding to CXCL10. Abolishes sulfation, binding to CXCL11, ligand-induced receptor internalization and CXCL9-, CXCL10- and CXCL11-induced chemotaxis; when associated with F-29. 2 Publications1
Mutagenesisi29Y → F: Reduces sulfation, binding to CXCL10 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. Abolishes sulfation, binding to CXCL10 and CXCL11 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis; when associated with F-27. 2 Publications1
Mutagenesisi112D → A: Abolishes binding to CXCL10 and CXCL11. Reduces CXCL9-, CXCL10- and CXCL11-induced chemotaxis. 1 Publication1
Mutagenesisi112D → K: Abolishes binding to CXCL10 and CXCL11 and CXCL10- and CXCL11-induced chemotaxis. Reduces CXCL9-induced chemotaxis. 1 Publication1
Mutagenesisi197R → A: Abolishes binding to CXCL10 and CXCL11 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. Reduces ligand-induced receptor internalization. 1 Publication1
Mutagenesisi212R → A: Abolishes CXCL10-induced chemotaxis. Reduces CXCL9- and CXCL11-induced chemotaxis. Does not affect binding to CXCL10 and CXCL11. 1 Publication1
Mutagenesisi216R → A: Reduces CXCL9-, CXCL10- and CXCL11-induced chemotaxis. Does not affect binding to CXCL10 and CXCL11 or receptor internalization. 1 Publication1
Mutagenesisi278D → A: Abolishes binding to CXCL10 and CXCL11 and CXCL11-induced chemotaxis. Reduces CXCL9 and CXCL10-induced chemotaxis. 1 Publication1
Mutagenesisi278D → K: Abolishes binding to CXCL10 and CXCL11 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. 1 Publication1
Mutagenesisi282D → A: Reduces binding to CXCL10 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. Abolishes binding to CXCL11. 1 Publication1
Mutagenesisi282D → K: Reduces binding to CXCL10 and CXCL11 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. 1 Publication1
Mutagenesisi293E → A: Reduces binding to CXCL10 and CXCL9- and CXCL11-induced chemotaxis. Abolishes binding to CXCL11 and CXCL10-induced chemotaxis. 1 Publication1
Mutagenesisi293E → K: Abolishes binding to CXCL10 and CXCL11 and CXCL9-, CXCL10- and CXCL11-induced chemotaxis. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
2833

Open Targets

More...
OpenTargetsi
ENSG00000186810

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35049

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4441

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
70

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CXCR3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2829400

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000693461 – 368C-X-C chemokine receptor type 3Add BLAST368

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi22N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27Sulfotyrosine2 Publications1
Modified residuei29Sulfotyrosine1 Publication1
Glycosylationi32N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi124 ↔ 203PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sulfation on Tyr-27 and Tyr-29 is essential for CXCL10 binding and subsequent signal transduction induction.2 Publications
N-glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein, Sulfation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P49682

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49682

PeptideAtlas

More...
PeptideAtlasi
P49682

PRoteomics IDEntifications database

More...
PRIDEi
P49682

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56047
56048 [P49682-2]
56049 [P49682-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49682

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49682

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186810 Expressed in 79 organ(s), highest expression level in leukocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_CXCR3

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49682 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045942

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homomer. Forms heteromers with ACKR4.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
FATE1Q969F03EBI-16432539,EBI-743099

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109094, 5 interactors

Database of interacting proteins

More...
DIPi
DIP-5891N

Protein interaction database and analysis system

More...
IntActi
P49682, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362795

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P49682

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P49682

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IE41 Eukaryota
ENOG410YWPA LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154109

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234122

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106917

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49682

KEGG Orthology (KO)

More...
KOi
K04188

Identification of Orthologs from Complete Genome Data

More...
OMAi
AYCYARI

Database of Orthologous Groups

More...
OrthoDBi
649708at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49682

TreeFam database of animal gene trees

More...
TreeFami
TF330966

Family and domain databases

Conserved Domains Database

More...
CDDi
cd15180 7tmA_CXCR3, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004070 Chemokine_CXCR3
IPR000355 Chemokine_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00657 CCCHEMOKINER
PR01532 CXCCHMKINER3
PR00237 GPCRRHODOPSN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P49682-1) [UniParc]FASTAAdd to basket
Also known as: CXCR3-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLEVSDHQV LNDAEVAALL ENFSSSYDYG ENESDSCCTS PPCPQDFSLN
60 70 80 90 100
FDRAFLPALY SLLFLLGLLG NGAVAAVLLS RRTALSSTDT FLLHLAVADT
110 120 130 140 150
LLVLTLPLWA VDAAVQWVFG SGLCKVAGAL FNINFYAGAL LLACISFDRY
160 170 180 190 200
LNIVHATQLY RRGPPARVTL TCLAVWGLCL LFALPDFIFL SAHHDERLNA
210 220 230 240 250
THCQYNFPQV GRTALRVLQL VAGFLLPLLV MAYCYAHILA VLLVSRGQRR
260 270 280 290 300
LRAMRLVVVV VVAFALCWTP YHLVVLVDIL MDLGALARNC GRESRVDVAK
310 320 330 340 350
SVTSGLGYMH CCLNPLLYAF VGVKFRERMW MLLLRLGCPN QRGLQRQPSS
360
SRRDSSWSET SEASYSGL
Length:368
Mass (Da):40,660
Last modified:November 1, 1997 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF08A3B44B2BBAD04
GO
Isoform 2 (identifier: P49682-2) [UniParc]FASTAAdd to basket
Also known as: CXCR3-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MVLE → MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSPFPPSQ

Show »
Length:415
Mass (Da):45,523
Checksum:i325C8A65982A43C4
GO
Isoform 3 (identifier: P49682-3) [UniParc]FASTAAdd to basket
Also known as: CXCR3-alt

The sequence of this isoform differs from the canonical sequence as follows:
     210-368: VGRTALRVLQ...ETSEASYSGL → GSSSGSGCGC...AGIRAPLSPI

Note: Due to exon skipping.
Show »
Length:267
Mass (Da):28,715
Checksum:i8E5C6052A5A3E518
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti75A → R in CAB02143 (Ref. 4) Curated1
Sequence conflicti157T → I in BAG36429 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_016240292R → Q1 PublicationCorresponds to variant dbSNP:rs139226823Ensembl.1
Natural variantiVAR_016241363A → T1 PublicationCorresponds to variant dbSNP:rs766348940Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0156841 – 4MVLE → MELRKYGPGRLAGTVIGGAA QSKSQTKSDSITKEFLPGLY TAPSSPFPPSQ in isoform 2. 2 Publications4
Alternative sequenceiVSP_015685210 – 368VGRTA…SYSGL → GSSSGSGCGCCSCAWAAPTR EGSRGSHRLPAGIHPGLRPQ RPPTRACEAGIRAPLSPI in isoform 3. CuratedAdd BLAST159

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X95876 mRNA Translation: CAA65126.1
AF469635 mRNA Translation: AAP55851.1
Z79783 Genomic DNA Translation: CAB02143.1
AY242128 mRNA Translation: AAO92295.1
AK313679 mRNA Translation: BAG36429.1
BC034403 mRNA Translation: AAH34403.1
U32674 Genomic DNA Translation: AAC50505.1
AB032735 Genomic DNA Translation: BAA92297.1
AB032736 Genomic DNA Translation: BAA92298.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14416.1 [P49682-1]
CCDS48135.1 [P49682-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001136269.1, NM_001142797.1 [P49682-2]
NP_001495.1, NM_001504.1 [P49682-1]
XP_016884924.1, XM_017029435.1 [P49682-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.198252

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373691; ENSP00000362795; ENSG00000186810 [P49682-2]
ENST00000373693; ENSP00000362797; ENSG00000186810 [P49682-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2833

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2833

UCSC genome browser

More...
UCSCi
uc004eaf.3 human [P49682-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
Wikipedia

CXC chemokine receptors entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X95876 mRNA Translation: CAA65126.1
AF469635 mRNA Translation: AAP55851.1
Z79783 Genomic DNA Translation: CAB02143.1
AY242128 mRNA Translation: AAO92295.1
AK313679 mRNA Translation: BAG36429.1
BC034403 mRNA Translation: AAH34403.1
U32674 Genomic DNA Translation: AAC50505.1
AB032735 Genomic DNA Translation: BAA92297.1
AB032736 Genomic DNA Translation: BAA92298.1
CCDSiCCDS14416.1 [P49682-1]
CCDS48135.1 [P49682-2]
RefSeqiNP_001136269.1, NM_001142797.1 [P49682-2]
NP_001495.1, NM_001504.1 [P49682-1]
XP_016884924.1, XM_017029435.1 [P49682-2]
UniGeneiHs.198252

3D structure databases

ProteinModelPortaliP49682
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109094, 5 interactors
DIPiDIP-5891N
IntActiP49682, 4 interactors
STRINGi9606.ENSP00000362795

Chemistry databases

BindingDBiP49682
ChEMBLiCHEMBL4441
GuidetoPHARMACOLOGYi70

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiP49682
PhosphoSitePlusiP49682

Polymorphism and mutation databases

BioMutaiCXCR3
DMDMi2829400

Proteomic databases

jPOSTiP49682
PaxDbiP49682
PeptideAtlasiP49682
PRIDEiP49682
ProteomicsDBi56047
56048 [P49682-2]
56049 [P49682-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2833
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373691; ENSP00000362795; ENSG00000186810 [P49682-2]
ENST00000373693; ENSP00000362797; ENSG00000186810 [P49682-1]
GeneIDi2833
KEGGihsa:2833
UCSCiuc004eaf.3 human [P49682-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2833
DisGeNETi2833
EuPathDBiHostDB:ENSG00000186810.7

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CXCR3
HGNCiHGNC:4540 CXCR3
HPAiHPA045942
MIMi300574 gene
neXtProtiNX_P49682
OpenTargetsiENSG00000186810
PharmGKBiPA35049

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IE41 Eukaryota
ENOG410YWPA LUCA
GeneTreeiENSGT00940000154109
HOGENOMiHOG000234122
HOVERGENiHBG106917
InParanoidiP49682
KOiK04188
OMAiAYCYARI
OrthoDBi649708at2759
PhylomeDBiP49682
TreeFamiTF330966

Enzyme and pathway databases

ReactomeiR-HSA-380108 Chemokine receptors bind chemokines
R-HSA-418594 G alpha (i) signalling events

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CXCR3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2833

Protein Ontology

More...
PROi
PR:P49682

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186810 Expressed in 79 organ(s), highest expression level in leukocyte
CleanExiHS_CXCR3
GenevisibleiP49682 HS

Family and domain databases

CDDicd15180 7tmA_CXCR3, 1 hit
InterProiView protein in InterPro
IPR004070 Chemokine_CXCR3
IPR000355 Chemokine_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00657 CCCHEMOKINER
PR01532 CXCCHMKINER3
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCXCR3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49682
Secondary accession number(s): B2R982
, O15185, Q7Z710, Q9P2T4, Q9P2T5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: November 1, 1997
Last modified: January 16, 2019
This is version 183 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again