Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal recognition particle 9 kDa protein

Gene

SRP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 7S RNA binding Source: InterPro
  • RNA binding Source: ProtInc
  • signal recognition particle binding Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRibonucleoprotein, RNA-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Protein family/group databases

Transport Classification Database

More...
TCDBi
3.A.5.9.1 the general secretory pathway (sec) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Signal recognition particle 9 kDa protein
Short name:
SRP9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SRP9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143742.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11304 SRP9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600707 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49458

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Signal recognition particle

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6726

Open Targets

More...
OpenTargetsi
ENSG00000143742

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36128

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SRP9

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1351111

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001351822 – 86Signal recognition particle 9 kDa proteinAdd BLAST85

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P49458

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P49458

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49458

PeptideAtlas

More...
PeptideAtlasi
P49458

PRoteomics IDEntifications database

More...
PRIDEi
P49458

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56016
56017 [P49458-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P49458-1 [P49458-1]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
P49458

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49458

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49458

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143742 Expressed in 91 organ(s), highest expression level in kidney

CleanEx database of gene expression profiles

More...
CleanExi
HS_SRP9

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49458 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49458 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112604, 58 interactors

Database of interacting proteins

More...
DIPi
DIP-6151N

Protein interaction database and analysis system

More...
IntActi
P49458, 26 interactors

Molecular INTeraction database

More...
MINTi
P49458

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000305230

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P49458

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49458

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P49458

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SRP9 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3465 Eukaryota
ENOG41123E8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018505

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000283871

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG060323

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49458

KEGG Orthology (KO)

More...
KOi
K03109

Identification of Orthologs from Complete Genome Data

More...
OMAi
VCLQYKT

Database of Orthologous Groups

More...
OrthoDBi
EOG091G15XS

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49458

TreeFam database of animal gene trees

More...
TreeFami
TF106246

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.720.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008832 Signal_recog_particle_SRP9
IPR009018 Signal_recog_particle_SRP9/14
IPR039914 SRP9/Srp21
IPR039432 SRP9_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12834 PTHR12834, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05486 SRP9-21, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF017029 Signal_recog_particle_SRP9, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54762 SSF54762, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P49458-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPQYQTWEEF SRAAEKLYLA DPMKARVVLK YRHSDGNLCV KVTDDLVCLV
60 70 80
YKTDQAQDVK KIEKFHSQLM RLMVAKEARN VTMETE
Length:86
Mass (Da):10,112
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB2CA071AF0E6F65
GO
Isoform 2 (identifier: P49458-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-86: CLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE → RQCLALLLRLQCSGMIIAHCILDLLGSSGPLASAS

Show »
Length:82
Mass (Da):9,124
Checksum:iD4C817FE1A6D7ED5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PE20E9PE20_HUMAN
Signal recognition particle 9 kDa p...
SRP9
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P49458-2)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64I → M in AAH21995 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04127048 – 86CLVYK…TMETE → RQCLALLLRLQCSGMIIAHC ILDLLGSSGPLASAS in isoform 2. 2 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U20998 mRNA Translation: AAA70170.1
EF488978 mRNA Translation: ABP02070.1
AK289595 mRNA Translation: BAF82284.1
CH471066 Genomic DNA Translation: EAW50106.1
CH471098 Genomic DNA Translation: EAW69750.1
CH471098 Genomic DNA Translation: EAW69751.1
BC008443 mRNA Translation: AAH08443.1
BC067845 mRNA Translation: AAH67845.1
BC021995 mRNA Translation: AAH21995.1
BC015094 mRNA Translation: AAH15094.1
BC022415 mRNA Translation: AAH22415.1
BC066957 mRNA Translation: AAH66957.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1546.1 [P49458-1]
CCDS44323.1 [P49458-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A57292

NCBI Reference Sequences

More...
RefSeqi
NP_001123912.1, NM_001130440.1 [P49458-2]
NP_003124.1, NM_003133.5 [P49458-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.511425
Hs.706900

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304786; ENSP00000305230; ENSG00000143742 [P49458-1]
ENST00000366839; ENSP00000355804; ENSG00000143742 [P49458-2]
ENST00000619790; ENSP00000485002; ENSG00000143742 [P49458-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6726

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6726

UCSC genome browser

More...
UCSCi
uc001hpg.4 human [P49458-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Signal recognition particle entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20998 mRNA Translation: AAA70170.1
EF488978 mRNA Translation: ABP02070.1
AK289595 mRNA Translation: BAF82284.1
CH471066 Genomic DNA Translation: EAW50106.1
CH471098 Genomic DNA Translation: EAW69750.1
CH471098 Genomic DNA Translation: EAW69751.1
BC008443 mRNA Translation: AAH08443.1
BC067845 mRNA Translation: AAH67845.1
BC021995 mRNA Translation: AAH21995.1
BC015094 mRNA Translation: AAH15094.1
BC022415 mRNA Translation: AAH22415.1
BC066957 mRNA Translation: AAH66957.1
CCDSiCCDS1546.1 [P49458-1]
CCDS44323.1 [P49458-2]
PIRiA57292
RefSeqiNP_001123912.1, NM_001130440.1 [P49458-2]
NP_003124.1, NM_003133.5 [P49458-1]
UniGeneiHs.511425
Hs.706900

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1E8OX-ray3.20A/C2-86[»]
1E8SX-ray4.00A2-86[»]
1RY1electron microscopy12.00C2-86[»]
4UYJX-ray3.35A/C1-85[»]
4UYKX-ray3.22A1-85[»]
5AOXX-ray2.04A/D2-86[»]
ProteinModelPortaliP49458
SMRiP49458
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112604, 58 interactors
DIPiDIP-6151N
IntActiP49458, 26 interactors
MINTiP49458
STRINGi9606.ENSP00000305230

Protein family/group databases

TCDBi3.A.5.9.1 the general secretory pathway (sec) family

PTM databases

CarbonylDBiP49458
iPTMnetiP49458
PhosphoSitePlusiP49458

Polymorphism and mutation databases

BioMutaiSRP9
DMDMi1351111

Proteomic databases

EPDiP49458
MaxQBiP49458
PaxDbiP49458
PeptideAtlasiP49458
PRIDEiP49458
ProteomicsDBi56016
56017 [P49458-2]
TopDownProteomicsiP49458-1 [P49458-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304786; ENSP00000305230; ENSG00000143742 [P49458-1]
ENST00000366839; ENSP00000355804; ENSG00000143742 [P49458-2]
ENST00000619790; ENSP00000485002; ENSG00000143742 [P49458-2]
GeneIDi6726
KEGGihsa:6726
UCSCiuc001hpg.4 human [P49458-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6726
DisGeNETi6726
EuPathDBiHostDB:ENSG00000143742.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SRP9
HGNCiHGNC:11304 SRP9
MIMi600707 gene
neXtProtiNX_P49458
OpenTargetsiENSG00000143742
PharmGKBiPA36128

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3465 Eukaryota
ENOG41123E8 LUCA
GeneTreeiENSGT00390000018505
HOGENOMiHOG000283871
HOVERGENiHBG060323
InParanoidiP49458
KOiK03109
OMAiVCLQYKT
OrthoDBiEOG091G15XS
PhylomeDBiP49458
TreeFamiTF106246

Enzyme and pathway databases

ReactomeiR-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SRP9 human
EvolutionaryTraceiP49458

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6726

Protein Ontology

More...
PROi
PR:P49458

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143742 Expressed in 91 organ(s), highest expression level in kidney
CleanExiHS_SRP9
ExpressionAtlasiP49458 baseline and differential
GenevisibleiP49458 HS

Family and domain databases

Gene3Di3.30.720.10, 1 hit
InterProiView protein in InterPro
IPR008832 Signal_recog_particle_SRP9
IPR009018 Signal_recog_particle_SRP9/14
IPR039914 SRP9/Srp21
IPR039432 SRP9_dom
PANTHERiPTHR12834 PTHR12834, 1 hit
PfamiView protein in Pfam
PF05486 SRP9-21, 1 hit
PIRSFiPIRSF017029 Signal_recog_particle_SRP9, 1 hit
SUPFAMiSSF54762 SSF54762, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRP09_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49458
Secondary accession number(s): A8K0N0, Q6NVX0, Q8WTW0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 180 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again