Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal recognition particle 9 kDa protein

Gene

SRP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

GO - Molecular functioni

  • 7S RNA binding Source: InterPro
  • RNA binding Source: ProtInc
  • signal recognition particle binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, RNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Protein family/group databases

TCDBi3.A.5.9.1 the general secretory pathway (sec) family

Names & Taxonomyi

Protein namesi
Recommended name:
Signal recognition particle 9 kDa protein
Short name:
SRP9
Gene namesi
Name:SRP9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000143742.12
HGNCiHGNC:11304 SRP9
MIMi600707 gene
neXtProtiNX_P49458

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Signal recognition particle

Pathology & Biotechi

Organism-specific databases

DisGeNETi6726
OpenTargetsiENSG00000143742
PharmGKBiPA36128

Polymorphism and mutation databases

BioMutaiSRP9
DMDMi1351111

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00001351822 – 86Signal recognition particle 9 kDa proteinAdd BLAST85

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei52N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP49458
MaxQBiP49458
PaxDbiP49458
PeptideAtlasiP49458
PRIDEiP49458
ProteomicsDBi56016
56017 [P49458-2]
TopDownProteomicsiP49458-1 [P49458-1]

PTM databases

CarbonylDBiP49458
iPTMnetiP49458
PhosphoSitePlusiP49458

Expressioni

Gene expression databases

BgeeiENSG00000143742 Expressed in 91 organ(s), highest expression level in kidney
CleanExiHS_SRP9
ExpressionAtlasiP49458 baseline and differential
GenevisibleiP49458 HS

Interactioni

Subunit structurei

Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi112604, 58 interactors
DIPiDIP-6151N
IntActiP49458, 26 interactors
MINTiP49458
STRINGi9606.ENSP00000305230

Structurei

Secondary structure

186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP49458
SMRiP49458
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49458

Family & Domainsi

Sequence similaritiesi

Belongs to the SRP9 family.Curated

Phylogenomic databases

eggNOGiKOG3465 Eukaryota
ENOG41123E8 LUCA
GeneTreeiENSGT00390000018505
HOGENOMiHOG000283871
HOVERGENiHBG060323
InParanoidiP49458
KOiK03109
OMAiVCLQYKT
OrthoDBiEOG091G15XS
PhylomeDBiP49458
TreeFamiTF106246

Family and domain databases

Gene3Di3.30.720.10, 1 hit
InterProiView protein in InterPro
IPR008832 Signal_recog_particle_SRP9
IPR009018 Signal_recog_particle_SRP9/14
IPR039914 SRP9/Srp21
IPR039432 SRP9_dom
PANTHERiPTHR12834 PTHR12834, 1 hit
PfamiView protein in Pfam
PF05486 SRP9-21, 1 hit
PIRSFiPIRSF017029 Signal_recog_particle_SRP9, 1 hit
SUPFAMiSSF54762 SSF54762, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P49458-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPQYQTWEEF SRAAEKLYLA DPMKARVVLK YRHSDGNLCV KVTDDLVCLV
60 70 80
YKTDQAQDVK KIEKFHSQLM RLMVAKEARN VTMETE
Length:86
Mass (Da):10,112
Last modified:January 23, 2007 - v2
Checksum:iDB2CA071AF0E6F65
GO
Isoform 2 (identifier: P49458-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-86: CLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE → RQCLALLLRLQCSGMIIAHCILDLLGSSGPLASAS

Show »
Length:82
Mass (Da):9,124
Checksum:iD4C817FE1A6D7ED5
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PE20E9PE20_HUMAN
Signal recognition particle 9 kDa p...
SRP9
66Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P49458-2)
Sequence conflicti64I → M in AAH21995 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04127048 – 86CLVYK…TMETE → RQCLALLLRLQCSGMIIAHC ILDLLGSSGPLASAS in isoform 2. 2 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20998 mRNA Translation: AAA70170.1
EF488978 mRNA Translation: ABP02070.1
AK289595 mRNA Translation: BAF82284.1
CH471066 Genomic DNA Translation: EAW50106.1
CH471098 Genomic DNA Translation: EAW69750.1
CH471098 Genomic DNA Translation: EAW69751.1
BC008443 mRNA Translation: AAH08443.1
BC067845 mRNA Translation: AAH67845.1
BC021995 mRNA Translation: AAH21995.1
BC015094 mRNA Translation: AAH15094.1
BC022415 mRNA Translation: AAH22415.1
BC066957 mRNA Translation: AAH66957.1
CCDSiCCDS1546.1 [P49458-1]
CCDS44323.1 [P49458-2]
PIRiA57292
RefSeqiNP_001123912.1, NM_001130440.1 [P49458-2]
NP_003124.1, NM_003133.5 [P49458-1]
UniGeneiHs.511425
Hs.706900

Genome annotation databases

EnsembliENST00000304786; ENSP00000305230; ENSG00000143742 [P49458-1]
ENST00000366839; ENSP00000355804; ENSG00000143742 [P49458-2]
ENST00000619790; ENSP00000485002; ENSG00000143742 [P49458-2]
GeneIDi6726
KEGGihsa:6726
UCSCiuc001hpg.4 human [P49458-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Signal recognition particle entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20998 mRNA Translation: AAA70170.1
EF488978 mRNA Translation: ABP02070.1
AK289595 mRNA Translation: BAF82284.1
CH471066 Genomic DNA Translation: EAW50106.1
CH471098 Genomic DNA Translation: EAW69750.1
CH471098 Genomic DNA Translation: EAW69751.1
BC008443 mRNA Translation: AAH08443.1
BC067845 mRNA Translation: AAH67845.1
BC021995 mRNA Translation: AAH21995.1
BC015094 mRNA Translation: AAH15094.1
BC022415 mRNA Translation: AAH22415.1
BC066957 mRNA Translation: AAH66957.1
CCDSiCCDS1546.1 [P49458-1]
CCDS44323.1 [P49458-2]
PIRiA57292
RefSeqiNP_001123912.1, NM_001130440.1 [P49458-2]
NP_003124.1, NM_003133.5 [P49458-1]
UniGeneiHs.511425
Hs.706900

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1E8OX-ray3.20A/C2-86[»]
1E8SX-ray4.00A2-86[»]
1RY1electron microscopy12.00C2-86[»]
4UYJX-ray3.35A/C1-85[»]
4UYKX-ray3.22A1-85[»]
5AOXX-ray2.04A/D2-86[»]
ProteinModelPortaliP49458
SMRiP49458
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112604, 58 interactors
DIPiDIP-6151N
IntActiP49458, 26 interactors
MINTiP49458
STRINGi9606.ENSP00000305230

Protein family/group databases

TCDBi3.A.5.9.1 the general secretory pathway (sec) family

PTM databases

CarbonylDBiP49458
iPTMnetiP49458
PhosphoSitePlusiP49458

Polymorphism and mutation databases

BioMutaiSRP9
DMDMi1351111

Proteomic databases

EPDiP49458
MaxQBiP49458
PaxDbiP49458
PeptideAtlasiP49458
PRIDEiP49458
ProteomicsDBi56016
56017 [P49458-2]
TopDownProteomicsiP49458-1 [P49458-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304786; ENSP00000305230; ENSG00000143742 [P49458-1]
ENST00000366839; ENSP00000355804; ENSG00000143742 [P49458-2]
ENST00000619790; ENSP00000485002; ENSG00000143742 [P49458-2]
GeneIDi6726
KEGGihsa:6726
UCSCiuc001hpg.4 human [P49458-1]

Organism-specific databases

CTDi6726
DisGeNETi6726
EuPathDBiHostDB:ENSG00000143742.12
GeneCardsiSRP9
HGNCiHGNC:11304 SRP9
MIMi600707 gene
neXtProtiNX_P49458
OpenTargetsiENSG00000143742
PharmGKBiPA36128
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3465 Eukaryota
ENOG41123E8 LUCA
GeneTreeiENSGT00390000018505
HOGENOMiHOG000283871
HOVERGENiHBG060323
InParanoidiP49458
KOiK03109
OMAiVCLQYKT
OrthoDBiEOG091G15XS
PhylomeDBiP49458
TreeFamiTF106246

Enzyme and pathway databases

ReactomeiR-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane

Miscellaneous databases

ChiTaRSiSRP9 human
EvolutionaryTraceiP49458
GenomeRNAii6726
PROiPR:P49458
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143742 Expressed in 91 organ(s), highest expression level in kidney
CleanExiHS_SRP9
ExpressionAtlasiP49458 baseline and differential
GenevisibleiP49458 HS

Family and domain databases

Gene3Di3.30.720.10, 1 hit
InterProiView protein in InterPro
IPR008832 Signal_recog_particle_SRP9
IPR009018 Signal_recog_particle_SRP9/14
IPR039914 SRP9/Srp21
IPR039432 SRP9_dom
PANTHERiPTHR12834 PTHR12834, 1 hit
PfamiView protein in Pfam
PF05486 SRP9-21, 1 hit
PIRSFiPIRSF017029 Signal_recog_particle_SRP9, 1 hit
SUPFAMiSSF54762 SSF54762, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSRP09_HUMAN
AccessioniPrimary (citable) accession number: P49458
Secondary accession number(s): A8K0N0, Q6NVX0, Q8WTW0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 180 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again