Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (03 Jul 2019)
Sequence version 2 (30 Aug 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tropomyosin-1, isoforms 33/34

Gene

Tm1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tropomyosin, in association with the troponin complex, plays a central role in the calcium dependent regulation of muscle contraction.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Muscle protein

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tropomyosin-1, isoforms 33/34
Alternative name(s):
Tropomyosin II
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tm1
Synonyms:TmII
ORF Names:CG4898
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0003721 Tm1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Protein family/group databases

Allergome; a platform for allergen knowledge

More...
Allergomei
1517 Dro m 7
4081 Dro m 7.0103

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002056851 – 518Tropomyosin-1, isoforms 33/34Add BLAST518

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49455

PRoteomics IDEntifications database

More...
PRIDEi
P49455

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Both isoforms are only expressed in indirect flight muscles.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Both isoforms are expressed during pupal and adult stages.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0003721 Expressed in 63 organ(s), highest expression level in crop (Drosophila)

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49455 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49455 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
66916, 29 interactors

Protein interaction database and analysis system

More...
IntActi
P49455, 25 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49455

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili14 – 267By similarityAdd BLAST254

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi287 – 518Ala/Pro-richAdd BLAST232

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The molecule is in a coiled coil structure that is formed by 2 polypeptide chains. The sequence exhibits a prominent seven-residues periodicity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tropomyosin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1003 Eukaryota
ENOG410XR5K LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182712

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49455

KEGG Orthology (KO)

More...
KOi
K10373

Identification of Orthologs from Complete Genome Data

More...
OMAi
QPANILK

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49455

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000533 Tropomyosin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00261 Tropomyosin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00194 TROPOMYOSIN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00326 TROPOMYOSIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 7 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 33 (identifier: P49455-1) [UniParc]FASTAAdd to basket
Also known as: 9C, K

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAIKKKMQA MKVDKDGALE RALVCEQEAR DANTRAEKAE EEARQLQKKI
60 70 80 90 100
QTVENELDQT QEALTLVTGK LEEKNKALQN AESEVAALNR RIQLLEEDLE
110 120 130 140 150
RSEERLGSAT AKLSEASQAA DESERARKIL ENRALADEER MDALENQLKE
160 170 180 190 200
ARFLAEEADK KYDEVARKLA MVEADLERAE ERAEQGENKI VELEEELRVV
210 220 230 240 250
GNNLKSLEVS EEKANQREEE YKNQIKTLNT RLKEAEARAE FAERSVQKLQ
260 270 280 290 300
KEVDRLEDDL IVEKERYCMI GDSLDEAFVD LIKGLEPFWN PRNPKPPTPK
310 320 330 340 350
LPTPTPEELA AMEEARAAAE AAAAAEAEAA EAAAAAGEAG PDGAPAAPGE
360 370 380 390 400
EKAPAKEPTP PKEPTPPPPP PPPFEYSIDL PPEGAEVPYV KNYEPPPPGS
410 420 430 440 450
EPEPVPAAEG EAAPAAEGAA PPAEGAAPPA EGAVPPADGA APPAEGAAPA
460 470 480 490 500
AEGAAPPADG AAPPAEAAAA PADAAAPAAE AAPAEAPAAE ATAAEAPPAE
510
AAPAEAAPAA AEGEAPPA
Length:518
Mass (Da):54,585
Last modified:August 30, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF431A313DE911D87
GO
Isoform 34 (identifier: P49455-2) [UniParc]FASTAAdd to basket
Also known as: 9B, F

The sequence of this isoform differs from the canonical sequence as follows:
     259-293: DLIVEKERYCMIGDSLDEAFVDLIKGLEPFWNPRN → EMIKEIEHYALVGDQLDWTFVEMMGMPPFYNERY
     300-367: KLPTPTPEEL...PTPPKEPTPP → ELTEEEKAAL...PPAEPERIPT
     391-518: KNYEPPPPGS...AAAEGEAPPA → RNAEPGDFAP...AAPAAEAPPA

Show »
Length:501
Mass (Da):53,370
Checksum:i82F9551D5F7F590D
GO
Isoform 9A (identifier: P06754-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P06754.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:284
Mass (Da):32,618
GO
Isoform A (identifier: P06754-2) [UniParc]FASTAAdd to basket
Also known as: Cytoskeletal, Non-muscle
The sequence of this isoform can be found in the external entry P06754.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:252
Mass (Da):29,297
GO
Isoform B (identifier: P06754-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P06754.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Length:339
Mass (Da):39,325
GO
Isoform D (identifier: P06754-1) [UniParc]FASTAAdd to basket
Also known as: 9D, G, J, Muscle
The sequence of this isoform can be found in the external entry P06754.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:285
Mass (Da):32,746
GO
Isoform L (identifier: P06754-5) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry P06754.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Length:284
Mass (Da):32,499
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
P06754TPM1_DROME
Tropomyosin-1, isoforms 9A/A/B
Tm1 TmII, CG4898
339Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8IGY1Q8IGY1_DROME
RE08101p
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
711Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KG06A0A0B4KG06_DROME
Tropomyosin 1, isoform S
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
285Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KG68A0A0B4KG68_DROME
Tropomyosin 1, isoform R
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
250Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K661A0A0B4K661_DROME
Tropomyosin 1, isoform Q
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
250Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6NN28Q6NN28_DROME
RE21974p
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
285Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8IG84Q8IG84_DROME
SD21996p
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
678Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q95TA3Q95TA3_DROME
GH09289p
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
441Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K6Y8A0A0B4K6Y8_DROME
Tropomyosin 1, isoform P
Tm1 10, 1305, 2299, BcDNA:GH09289, BcDNA:LD37158
161Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti106 – 114LGSATAKLS → SASAIQLAA in AAA28967 (PubMed:3097506).Curated9
Sequence conflicti119A → S in AAA28967 (PubMed:3097506).Curated1
Sequence conflicti119A → S in AAA28968 (PubMed:3097506).Curated1
Sequence conflicti183A → AMVEADLERAEERA (PubMed:3097506).Curated1
Sequence conflicti199V → L in AAA28967 (PubMed:3097506).Curated1
Sequence conflicti199V → L in AAA28968 (PubMed:3097506).Curated1
Sequence conflicti298 – 299TP → A in AAA28967 (PubMed:3097506).Curated2
Sequence conflicti341P → A in CAA53800 (PubMed:2851721).Curated1
Sequence conflicti341P → A in AAA28968 (PubMed:3097506).Curated1
Sequence conflicti503P → A in AAA28968 (PubMed:3097506).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006623259 – 293DLIVE…WNPRN → EMIKEIEHYALVGDQLDWTF VEMMGMPPFYNERY in isoform 34. CuratedAdd BLAST35
Alternative sequenceiVSP_006624300 – 367KLPTP…EPTPP → ELTEEEKAALEAAAIAEAEA KARAEELAALGEEAGAEAGE GGAPAEGAAPGEPGAATEPG VEAPPAEPERIPT in isoform 34. CuratedAdd BLAST68
Alternative sequenceiVSP_006625391 – 518KNYEP…EAPPA → RNAEPGDFAPPAEAAPAEGA PPAEGAPAAEGAAPAEGAPA AEGAPPAEGAPAPAPAEGEA APPAPAAEGDAAAAPPPPPA EGEAAPAPAEGEAPPAEAAP AAEAPPA in isoform 34. CuratedAdd BLAST128

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X76208 Genomic DNA Translation: CAA53800.1
X76208 Genomic DNA Translation: CAA53801.1
K02620
, L00355, L00356, L00357, L00358, L00359, L00360, L00362, M12840 Genomic DNA Translation: AAA28967.1 Sequence problems.
K02621
, M12840, L00355, L00356, L00357, L00358, L00359, L00360, L00362 Genomic DNA Translation: AAA28968.1
AE014297 Genomic DNA Translation: AAN13647.2
AE014297 Genomic DNA Translation: AAS65155.1

Protein sequence database of the Protein Information Resource

More...
PIRi
B25242

NCBI Reference Sequences

More...
RefSeqi
NP_732005.2, NM_169637.4 [P49455-2]
NP_996217.1, NM_206495.2 [P49455-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0089957; FBpp0088896; FBgn0003721 [P49455-1]
FBtr0089959; FBpp0088898; FBgn0003721 [P49455-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
41852

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4898

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76208 Genomic DNA Translation: CAA53800.1
X76208 Genomic DNA Translation: CAA53801.1
K02620
, L00355, L00356, L00357, L00358, L00359, L00360, L00362, M12840 Genomic DNA Translation: AAA28967.1 Sequence problems.
K02621
, M12840, L00355, L00356, L00357, L00358, L00359, L00360, L00362 Genomic DNA Translation: AAA28968.1
AE014297 Genomic DNA Translation: AAN13647.2
AE014297 Genomic DNA Translation: AAS65155.1
PIRiB25242
RefSeqiNP_732005.2, NM_169637.4 [P49455-2]
NP_996217.1, NM_206495.2 [P49455-1]

3D structure databases

SMRiP49455
ModBaseiSearch...

Protein-protein interaction databases

BioGridi66916, 29 interactors
IntActiP49455, 25 interactors

Protein family/group databases

Allergomei1517 Dro m 7
4081 Dro m 7.0103

Proteomic databases

PaxDbiP49455
PRIDEiP49455

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0089957; FBpp0088896; FBgn0003721 [P49455-1]
FBtr0089959; FBpp0088898; FBgn0003721 [P49455-2]
GeneIDi41852
KEGGidme:Dmel_CG4898

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
41852
FlyBaseiFBgn0003721 Tm1

Phylogenomic databases

eggNOGiKOG1003 Eukaryota
ENOG410XR5K LUCA
GeneTreeiENSGT00950000182712
InParanoidiP49455
KOiK10373
OMAiQPANILK
PhylomeDBiP49455

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
41852

Gene expression databases

BgeeiFBgn0003721 Expressed in 63 organ(s), highest expression level in crop (Drosophila)
ExpressionAtlasiP49455 baseline and differential
GenevisibleiP49455 DM

Family and domain databases

InterProiView protein in InterPro
IPR000533 Tropomyosin
PfamiView protein in Pfam
PF00261 Tropomyosin, 1 hit
PRINTSiPR00194 TROPOMYOSIN
PROSITEiView protein in PROSITE
PS00326 TROPOMYOSIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPM4_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49455
Secondary accession number(s): P49456
, Q24425, Q24426, Q7KSH9, Q7KSI0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: August 30, 2005
Last modified: July 3, 2019
This is version 138 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again