Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 193 (26 Feb 2020)
Sequence version 1 (01 Feb 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein farnesyltransferase subunit beta

Gene

FNTB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+6 PublicationsNote: Binds 1 zinc ion per subunit.6 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei102Important for selectivity against geranylgeranyl diphosphate1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi297Zinc; catalytic1
Metal bindingi299Zinc; catalytic1
Metal bindingi362Zinc; via tele nitrogen; catalytic1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein farnesyltransferase activity Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionPrenyltransferase, Transferase
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2514859 Inactivation, recovery and regulation of the phototransduction cascade

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P49356

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein farnesyltransferase subunit beta (EC:2.5.1.58)
Short name:
FTase-beta
Alternative name(s):
CAAX farnesyltransferase subunit beta
Ras proteins prenyltransferase subunit beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FNTB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3785 FNTB

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
134636 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49356

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi102W → T: Removes the steric hindrance that normally precludes geranylgeranyl diphosphate binding. Reduces farnesyltransferase activity and confers geranylgeranyltransferase activity. 1 Publication1
Mutagenesisi200D → N: Reduced catalytic efficiency. 1 Publication1
Mutagenesisi249G → V: Reduced catalytic efficiency. 1 Publication1
Mutagenesisi349G → S: Reduced catalytic efficiency. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
100529261
2342

Open Targets

More...
OpenTargetsi
ENSG00000257365

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28202

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P49356 Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL272

Drug and drug target database

More...
DrugBanki
DB07216 (11S)-8-CHLORO-11-[1-(METHYLSULFONYL)PIPERIDIN-4-YL]-6-PIPERAZIN-1-YL-11H-BENZO[5,6]CYCLOHEPTA[1,2-B]PYRIDINE
DB08674 (20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRIAZA-CYCLOOCTADECOSINE-9-CARBONITRILE
DB08676 (20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIAZACYCLONOADECOSINE-9-CARBONITRILE
DB06953 2-CHLORO-5-(3-CHLORO-PHENYL)-6-[(4-CYANO-PHENYL)-(3-METHYL-3H-IMIDAZOL-4-YL)- METHOXYMETHYL]-NICOTINONITRILE
DB07227 4-[(5-{[4-(3-CHLOROPHENYL)-3-OXOPIPERAZIN-1-YL]METHYL}-1H-IMIDAZOL-1-YL)METHYL]BENZONITRILE
DB07771 [(3,7,11-TRIMETHYL-DODECA-2,6,10-TRIENYLOXYCARBAMOYL)-METHYL]-PHOSPHONIC ACID
DB07895 ALPHA-HYDROXYFARNESYLPHOSPHONIC ACID
DB04893 AZD3409
DB07780 Farnesyl diphosphate
DB07841 Geranylgeranyl diphosphate
DB04960 Tipifarnib

DrugCentral

More...
DrugCentrali
P49356

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2826

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FNTB

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1346696

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001197611 – 437Protein farnesyltransferase subunit betaAdd BLAST437

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei436PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P49356

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P49356

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P49356

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P49356

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49356

PeptideAtlas

More...
PeptideAtlasi
P49356

PRoteomics IDEntifications database

More...
PRIDEi
P49356

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
55995 [P49356-1]
5739

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49356

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49356

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000257365 Expressed in C1 segment of cervical spinal cord and 91 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49356 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49356 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062743

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of FNTA and FNTB.

7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P4935411EBI-602349,EBI-602336

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108627, 54 interactors
1529403, 2 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-2165 Protein farnesyltransferase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P49356

Protein interaction database and analysis system

More...
IntActi
P49356, 51 interactors

Molecular INTeraction database

More...
MINTi
P49356

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000246166

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P49356

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P49356 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1437
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P49356

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P49356

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati123 – 164PFTB 1Add BLAST42
Repeati174 – 215PFTB 2Add BLAST42
Repeati222 – 263PFTB 3Add BLAST42
Repeati270 – 312PFTB 4Add BLAST43
Repeati332 – 374PFTB 5Add BLAST43

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni248 – 251Farnesyl diphosphate binding4
Regioni291 – 294Farnesyl diphosphate binding4
Regioni300 – 303Farnesyl diphosphate binding4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0365 Eukaryota
COG5029 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183128

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_028946_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49356

KEGG Orthology (KO)

More...
KOi
K05954

Identification of Orthologs from Complete Genome Data

More...
OMAi
ENCIDFI

Database of Orthologous Groups

More...
OrthoDBi
1042804at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49356

TreeFam database of animal gene trees

More...
TreeFami
TF353162

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02893 FTase, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026872 FTB
IPR001330 PFTB_repeat
IPR008930 Terpenoid_cyclase/PrenylTrfase

The PANTHER Classification System

More...
PANTHERi
PTHR11774:SF6 PTHR11774:SF6, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00432 Prenyltrans, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48239 SSF48239, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P49356-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPSSFTYY CPPSSSPVWS EPLYSLRPEH ARERLQDDSV ETVTSIEQAK
60 70 80 90 100
VEEKIQEVFS SYKFNHLVPR LVLQREKHFH YLKRGLRQLT DAYECLDASR
110 120 130 140 150
PWLCYWILHS LELLDEPIPQ IVATDVCQFL ELCQSPEGGF GGGPGQYPHL
160 170 180 190 200
APTYAAVNAL CIIGTEEAYD IINREKLLQY LYSLKQPDGS FLMHVGGEVD
210 220 230 240 250
VRSAYCAASV ASLTNIITPD LFEGTAEWIA RCQNWEGGIG GVPGMEAHGG
260 270 280 290 300
YTFCGLAALV ILKRERSLNL KSLLQWVTSR QMRFEGGFQG RCNKLVDGCY
310 320 330 340 350
SFWQAGLLPL LHRALHAQGD PALSMSHWMF HQQALQEYIL MCCQCPAGGL
360 370 380 390 400
LDKPGKSRDF YHTCYCLSGL SIAQHFGSGA MLHDVVLGVP ENALQPTHPV
410 420 430
YNIGPDKVIQ ATTYFLQKPV PGFEELKDET SAEPATD
Length:437
Mass (Da):48,774
Last modified:February 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8E8E571846146709
GO
Isoform 2 (identifier: P49356-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQ → MI

Show »
Length:391
Mass (Da):43,574
Checksum:i00AC66972207B800
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti283R → L in AAA86286 (PubMed:8276393).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0546571 – 48MASPS…TSIEQ → MI in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L00635 mRNA Translation: AAA35854.1
AK303739 mRNA Translation: BAG64712.1
AK315714 mRNA Translation: BAG38073.1
AL135745 Genomic DNA No translation available.
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80897.1
BC020232 mRNA Translation: AAH20232.1
L10414 mRNA Translation: AAA86286.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9769.1 [P49356-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
B49274

NCBI Reference Sequences

More...
RefSeqi
NP_001189487.1, NM_001202558.1 [P49356-2]
NP_002019.1, NM_002028.3 [P49356-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000246166; ENSP00000246166; ENSG00000257365 [P49356-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100529261
2342

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100529261
hsa:2342

UCSC genome browser

More...
UCSCi
uc001xia.4 human [P49356-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00635 mRNA Translation: AAA35854.1
AK303739 mRNA Translation: BAG64712.1
AK315714 mRNA Translation: BAG38073.1
AL135745 Genomic DNA No translation available.
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80897.1
BC020232 mRNA Translation: AAH20232.1
L10414 mRNA Translation: AAA86286.1
CCDSiCCDS9769.1 [P49356-1]
PIRiB49274
RefSeqiNP_001189487.1, NM_001202558.1 [P49356-2]
NP_002019.1, NM_002028.3 [P49356-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JCQX-ray2.30B1-437[»]
1LD7X-ray2.00B1-437[»]
1LD8X-ray1.80B1-437[»]
1MZCX-ray2.00B1-437[»]
1S63X-ray1.90B1-437[»]
1SA4X-ray2.10B1-437[»]
1TN6X-ray1.80B1-437[»]
2F0YX-ray2.70B1-437[»]
2H6FX-ray1.50B1-437[»]
2H6GX-ray1.85B1-437[»]
2H6HX-ray1.80B1-437[»]
2H6IX-ray3.00B1-437[»]
2IEJX-ray1.80B1-437[»]
3E37X-ray1.80B1-437[»]
SMRiP49356
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi108627, 54 interactors
1529403, 2 interactors
ComplexPortaliCPX-2165 Protein farnesyltransferase complex
CORUMiP49356
IntActiP49356, 51 interactors
MINTiP49356
STRINGi9606.ENSP00000246166

Chemistry databases

BindingDBiP49356
ChEMBLiCHEMBL272
DrugBankiDB07216 (11S)-8-CHLORO-11-[1-(METHYLSULFONYL)PIPERIDIN-4-YL]-6-PIPERAZIN-1-YL-11H-BENZO[5,6]CYCLOHEPTA[1,2-B]PYRIDINE
DB08674 (20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRIAZA-CYCLOOCTADECOSINE-9-CARBONITRILE
DB08676 (20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIAZACYCLONOADECOSINE-9-CARBONITRILE
DB06953 2-CHLORO-5-(3-CHLORO-PHENYL)-6-[(4-CYANO-PHENYL)-(3-METHYL-3H-IMIDAZOL-4-YL)- METHOXYMETHYL]-NICOTINONITRILE
DB07227 4-[(5-{[4-(3-CHLOROPHENYL)-3-OXOPIPERAZIN-1-YL]METHYL}-1H-IMIDAZOL-1-YL)METHYL]BENZONITRILE
DB07771 [(3,7,11-TRIMETHYL-DODECA-2,6,10-TRIENYLOXYCARBAMOYL)-METHYL]-PHOSPHONIC ACID
DB07895 ALPHA-HYDROXYFARNESYLPHOSPHONIC ACID
DB04893 AZD3409
DB07780 Farnesyl diphosphate
DB07841 Geranylgeranyl diphosphate
DB04960 Tipifarnib
DrugCentraliP49356
GuidetoPHARMACOLOGYi2826

PTM databases

iPTMnetiP49356
PhosphoSitePlusiP49356

Polymorphism and mutation databases

BioMutaiFNTB
DMDMi1346696

Proteomic databases

EPDiP49356
jPOSTiP49356
MassIVEiP49356
MaxQBiP49356
PaxDbiP49356
PeptideAtlasiP49356
PRIDEiP49356
ProteomicsDBi55995 [P49356-1]
5739

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2342

Genome annotation databases

EnsembliENST00000246166; ENSP00000246166; ENSG00000257365 [P49356-1]
GeneIDi100529261
2342
KEGGihsa:100529261
hsa:2342
UCSCiuc001xia.4 human [P49356-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100529261
2342
DisGeNETi100529261
2342

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FNTB
HGNCiHGNC:3785 FNTB
HPAiHPA062743
MIMi134636 gene
neXtProtiNX_P49356
OpenTargetsiENSG00000257365
PharmGKBiPA28202

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0365 Eukaryota
COG5029 LUCA
GeneTreeiENSGT00950000183128
HOGENOMiCLU_028946_0_1_1
InParanoidiP49356
KOiK05954
OMAiENCIDFI
OrthoDBi1042804at2759
PhylomeDBiP49356
TreeFamiTF353162

Enzyme and pathway databases

ReactomeiR-HSA-2514859 Inactivation, recovery and regulation of the phototransduction cascade
SIGNORiP49356

Miscellaneous databases

EvolutionaryTraceiP49356

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FNTB
PharosiP49356 Tchem

Protein Ontology

More...
PROi
PR:P49356
RNActiP49356 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000257365 Expressed in C1 segment of cervical spinal cord and 91 other tissues
ExpressionAtlasiP49356 baseline and differential
GenevisibleiP49356 HS

Family and domain databases

CDDicd02893 FTase, 1 hit
InterProiView protein in InterPro
IPR026872 FTB
IPR001330 PFTB_repeat
IPR008930 Terpenoid_cyclase/PrenylTrfase
PANTHERiPTHR11774:SF6 PTHR11774:SF6, 1 hit
PfamiView protein in Pfam
PF00432 Prenyltrans, 5 hits
SUPFAMiSSF48239 SSF48239, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFNTB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49356
Secondary accession number(s): B2RDX6, B4E1A0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: February 26, 2020
This is version 193 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again