Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein farnesyltransferase subunit beta

Gene

FNTB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.5 Publications

Catalytic activityi

Farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.5 Publications

Cofactori

Zn2+6 PublicationsNote: Binds 1 zinc ion per subunit.6 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei102Important for selectivity against geranylgeranyl diphosphate1
Metal bindingi297Zinc; catalytic1
Metal bindingi299Zinc; catalytic1
Metal bindingi362Zinc; via tele nitrogen; catalytic1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionPrenyltransferase, Transferase
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-2514859 Inactivation, recovery and regulation of the phototransduction cascade
SIGNORiP49356

Names & Taxonomyi

Protein namesi
Recommended name:
Protein farnesyltransferase subunit beta (EC:2.5.1.58)
Short name:
FTase-beta
Alternative name(s):
CAAX farnesyltransferase subunit beta
Ras proteins prenyltransferase subunit beta
Gene namesi
Name:FNTB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000257365.7
HGNCiHGNC:3785 FNTB
MIMi134636 gene
neXtProtiNX_P49356

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi102W → T: Removes the steric hindrance that normally precludes geranylgeranyl diphosphate binding. Reduces farnesyltransferase activity and confers geranylgeranyltransferase activity. 1 Publication1
Mutagenesisi200D → N: Reduced catalytic efficiency. 1 Publication1
Mutagenesisi249G → V: Reduced catalytic efficiency. 1 Publication1
Mutagenesisi349G → S: Reduced catalytic efficiency. 1 Publication1

Organism-specific databases

DisGeNETi2342
OpenTargetsiENSG00000257365
PharmGKBiPA28202

Chemistry databases

ChEMBLiCHEMBL272
DrugBankiDB06953 2-CHLORO-5-(3-CHLORO-PHENYL)-6-[(4-CYANO-PHENYL)-(3-METHYL-3H-IMIDAZOL-4-YL)- METHOXYMETHYL]-NICOTINONITRILE
DB07227 4-[(5-{[4-(3-CHLOROPHENYL)-3-OXOPIPERAZIN-1-YL]METHYL}-1H-IMIDAZOL-1-YL)METHYL]BENZONITRILE
DB07895 ALPHA-HYDROXYFARNESYLPHOSPHONIC ACID
DB04893 AZD3409
DB07780 FARNESYL DIPHOSPHATE
DB07841 GERANYLGERANYL DIPHOSPHATE
DB04960 Tipifarnib
GuidetoPHARMACOLOGYi2826

Polymorphism and mutation databases

BioMutaiFNTB
DMDMi1346696

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001197611 – 437Protein farnesyltransferase subunit betaAdd BLAST437

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei436PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP49356
MaxQBiP49356
PaxDbiP49356
PeptideAtlasiP49356
PRIDEiP49356
ProteomicsDBi55995

PTM databases

iPTMnetiP49356
PhosphoSitePlusiP49356

Expressioni

Gene expression databases

BgeeiENSG00000257365 Expressed in 92 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_FNTB
GenevisibleiP49356 HS

Organism-specific databases

HPAiHPA062743

Interactioni

Subunit structurei

Heterodimer of FNTA and FNTB.7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FNTAP4935411EBI-602349,EBI-602336

Protein-protein interaction databases

BioGridi108627, 54 interactors
1529403, 2 interactors
ComplexPortaliCPX-2165 Protein farnesyltransferase complex
CORUMiP49356
IntActiP49356, 11 interactors
MINTiP49356
STRINGi9606.ENSP00000246166

Chemistry databases

BindingDBiP49356

Structurei

Secondary structure

1437
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP49356
SMRiP49356
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49356

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati123 – 164PFTB 1Add BLAST42
Repeati174 – 215PFTB 2Add BLAST42
Repeati222 – 263PFTB 3Add BLAST42
Repeati270 – 312PFTB 4Add BLAST43
Repeati332 – 374PFTB 5Add BLAST43

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni248 – 251Farnesyl diphosphate binding4
Regioni291 – 294Farnesyl diphosphate binding4
Regioni300 – 303Farnesyl diphosphate binding4

Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0365 Eukaryota
COG5029 LUCA
GeneTreeiENSGT00550000075042
HOVERGENiHBG008173
InParanoidiP49356
KOiK05954
OMAiRRSYEEI
OrthoDBiEOG091G08TB
PhylomeDBiP49356
TreeFamiTF353162

Family and domain databases

CDDicd02893 FTase, 1 hit
InterProiView protein in InterPro
IPR026872 FTB
IPR001330 PFTB_repeat
IPR008930 Terpenoid_cyclase/PrenylTrfase
PANTHERiPTHR11774:SF6 PTHR11774:SF6, 1 hit
PfamiView protein in Pfam
PF00432 Prenyltrans, 5 hits
SUPFAMiSSF48239 SSF48239, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P49356-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPSSFTYY CPPSSSPVWS EPLYSLRPEH ARERLQDDSV ETVTSIEQAK
60 70 80 90 100
VEEKIQEVFS SYKFNHLVPR LVLQREKHFH YLKRGLRQLT DAYECLDASR
110 120 130 140 150
PWLCYWILHS LELLDEPIPQ IVATDVCQFL ELCQSPEGGF GGGPGQYPHL
160 170 180 190 200
APTYAAVNAL CIIGTEEAYD IINREKLLQY LYSLKQPDGS FLMHVGGEVD
210 220 230 240 250
VRSAYCAASV ASLTNIITPD LFEGTAEWIA RCQNWEGGIG GVPGMEAHGG
260 270 280 290 300
YTFCGLAALV ILKRERSLNL KSLLQWVTSR QMRFEGGFQG RCNKLVDGCY
310 320 330 340 350
SFWQAGLLPL LHRALHAQGD PALSMSHWMF HQQALQEYIL MCCQCPAGGL
360 370 380 390 400
LDKPGKSRDF YHTCYCLSGL SIAQHFGSGA MLHDVVLGVP ENALQPTHPV
410 420 430
YNIGPDKVIQ ATTYFLQKPV PGFEELKDET SAEPATD
Length:437
Mass (Da):48,774
Last modified:February 1, 1996 - v1
Checksum:i8E8E571846146709
GO
Isoform 2 (identifier: P49356-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQ → MI

Note: No experimental confirmation available.
Show »
Length:391
Mass (Da):43,574
Checksum:i00AC66972207B800
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti283R → L in AAA86286 (PubMed:8276393).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0546571 – 48MASPS…TSIEQ → MI in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00635 mRNA Translation: AAA35854.1
AK303739 mRNA Translation: BAG64712.1
AK315714 mRNA Translation: BAG38073.1
AL135745 Genomic DNA No translation available.
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80897.1
BC020232 mRNA Translation: AAH20232.1
L10414 mRNA Translation: AAA86286.1
CCDSiCCDS9769.1 [P49356-1]
PIRiB49274
RefSeqiNP_001189487.1, NM_001202558.1 [P49356-2]
NP_002019.1, NM_002028.3 [P49356-1]
UniGeneiHs.325531

Genome annotation databases

EnsembliENST00000246166; ENSP00000246166; ENSG00000257365 [P49356-1]
GeneIDi100529261
2342
KEGGihsa:100529261
hsa:2342
UCSCiuc001xia.4 human [P49356-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00635 mRNA Translation: AAA35854.1
AK303739 mRNA Translation: BAG64712.1
AK315714 mRNA Translation: BAG38073.1
AL135745 Genomic DNA No translation available.
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80897.1
BC020232 mRNA Translation: AAH20232.1
L10414 mRNA Translation: AAA86286.1
CCDSiCCDS9769.1 [P49356-1]
PIRiB49274
RefSeqiNP_001189487.1, NM_001202558.1 [P49356-2]
NP_002019.1, NM_002028.3 [P49356-1]
UniGeneiHs.325531

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JCQX-ray2.30B1-437[»]
1LD7X-ray2.00B1-437[»]
1LD8X-ray1.80B1-437[»]
1MZCX-ray2.00B1-437[»]
1S63X-ray1.90B1-437[»]
1SA4X-ray2.10B1-437[»]
1TN6X-ray1.80B1-437[»]
2F0YX-ray2.70B1-437[»]
2H6FX-ray1.50B1-437[»]
2H6GX-ray1.85B1-437[»]
2H6HX-ray1.80B1-437[»]
2H6IX-ray3.00B1-437[»]
2IEJX-ray1.80B1-437[»]
3E37X-ray1.80B1-437[»]
ProteinModelPortaliP49356
SMRiP49356
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108627, 54 interactors
1529403, 2 interactors
ComplexPortaliCPX-2165 Protein farnesyltransferase complex
CORUMiP49356
IntActiP49356, 11 interactors
MINTiP49356
STRINGi9606.ENSP00000246166

Chemistry databases

BindingDBiP49356
ChEMBLiCHEMBL272
DrugBankiDB06953 2-CHLORO-5-(3-CHLORO-PHENYL)-6-[(4-CYANO-PHENYL)-(3-METHYL-3H-IMIDAZOL-4-YL)- METHOXYMETHYL]-NICOTINONITRILE
DB07227 4-[(5-{[4-(3-CHLOROPHENYL)-3-OXOPIPERAZIN-1-YL]METHYL}-1H-IMIDAZOL-1-YL)METHYL]BENZONITRILE
DB07895 ALPHA-HYDROXYFARNESYLPHOSPHONIC ACID
DB04893 AZD3409
DB07780 FARNESYL DIPHOSPHATE
DB07841 GERANYLGERANYL DIPHOSPHATE
DB04960 Tipifarnib
GuidetoPHARMACOLOGYi2826

PTM databases

iPTMnetiP49356
PhosphoSitePlusiP49356

Polymorphism and mutation databases

BioMutaiFNTB
DMDMi1346696

Proteomic databases

EPDiP49356
MaxQBiP49356
PaxDbiP49356
PeptideAtlasiP49356
PRIDEiP49356
ProteomicsDBi55995

Protocols and materials databases

DNASUi2342
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000246166; ENSP00000246166; ENSG00000257365 [P49356-1]
GeneIDi100529261
2342
KEGGihsa:100529261
hsa:2342
UCSCiuc001xia.4 human [P49356-1]

Organism-specific databases

CTDi100529261
2342
DisGeNETi2342
EuPathDBiHostDB:ENSG00000257365.7
GeneCardsiFNTB
HGNCiHGNC:3785 FNTB
HPAiHPA062743
MIMi134636 gene
neXtProtiNX_P49356
OpenTargetsiENSG00000257365
PharmGKBiPA28202
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0365 Eukaryota
COG5029 LUCA
GeneTreeiENSGT00550000075042
HOVERGENiHBG008173
InParanoidiP49356
KOiK05954
OMAiRRSYEEI
OrthoDBiEOG091G08TB
PhylomeDBiP49356
TreeFamiTF353162

Enzyme and pathway databases

ReactomeiR-HSA-2514859 Inactivation, recovery and regulation of the phototransduction cascade
SIGNORiP49356

Miscellaneous databases

EvolutionaryTraceiP49356
GeneWikiiFNTB
PROiPR:P49356
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000257365 Expressed in 92 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_FNTB
GenevisibleiP49356 HS

Family and domain databases

CDDicd02893 FTase, 1 hit
InterProiView protein in InterPro
IPR026872 FTB
IPR001330 PFTB_repeat
IPR008930 Terpenoid_cyclase/PrenylTrfase
PANTHERiPTHR11774:SF6 PTHR11774:SF6, 1 hit
PfamiView protein in Pfam
PF00432 Prenyltrans, 5 hits
SUPFAMiSSF48239 SSF48239, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFNTB_HUMAN
AccessioniPrimary (citable) accession number: P49356
Secondary accession number(s): B2RDX6, B4E1A0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: November 7, 2018
This is version 184 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again