UniProtKB - P49327 (FAS_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
>sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3 MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH SPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATL PRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGP EVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLS TDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFE FVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEA QWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCT IIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL AWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLA RALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQ WDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRL LWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQVADVVV SRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQL CKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQ VLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLL SPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVA ALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESL FSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRP VWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGD LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGDLSSIRWVCSSLRHAQPTCPG AQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAK GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGV GQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKG VDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFF NESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEE PEAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGI RTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLL ENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSA MERICEKRRHEGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSV EVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLD SIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGS PTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAA VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGA DYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREGCommunity curation ()Add a publicationFeedback
Fatty acid synthase
FASN
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.13"Fatty acid synthase: a novel target for antiglioma therapy."
Zhao W., Kridel S., Thorburn A., Kooshki M., Little J., Hebbar S., Robbins M.
Br. J. Cancer 95:869-878(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, ACTIVITY REGULATION. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Miscellaneous
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi
- acetyl-CoAEC:2.3.1.85
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
acetyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+2nH+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+nmalonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+2nNADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=a long-chain fatty acid- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+nCO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+(n+1)CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+2nNADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- acetyl-CoAEC:2.3.1.38
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
acetyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=acetyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-acetylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- holo-[ACP]EC:2.3.1.39
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- a fatty acyl-[ACP]EC:2.3.1.41
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a fatty acyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-fatty acylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=a 3-oxoacyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxoacylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- a (3R)-hydroxyacyl-[ACP]EC:1.1.1.100
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
This reaction proceeds in the backward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a (3R)-hydroxyacyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
(3R)-hydroxyacyl-pantetheine-4-phosphorylserine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=a 3-oxoacyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxoacylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- a (3R)-hydroxyacyl-[ACP]EC:4.2.1.59
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a (3R)-hydroxyacyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
(3R)-hydroxyacyl-pantetheine-4-phosphorylserine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=a (2E)-enoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-(2E)-enoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- a 2,3-saturated acyl-[ACP]EC:1.3.1.39
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
This reaction proceeds in the backward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a 2,3-saturated acyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-(2,3-saturated)-acylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=a (2E)-enoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-(2E)-enoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H2OEC:3.1.2.14
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.30"Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain."
Chakravarty B., Gu Z., Chirala S.S., Wakil S.J., Quiocho F.A.
Proc. Natl. Acad. Sci. U.S.A. 101:15567-15572(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 2218-2502, CATALYTIC ACTIVITY.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.30"Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain."
Chakravarty B., Gu Z., Chirala S.S., Wakil S.J., Quiocho F.A.
Proc. Natl. Acad. Sci. U.S.A. 101:15567-15572(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 2218-2502, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.30"Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain."
Chakravarty B., Gu Z., Chirala S.S., Wakil S.J., Quiocho F.A.
Proc. Natl. Acad. Sci. U.S.A. 101:15567-15572(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 2218-2502, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+hexadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-hexadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+hexadecanoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- acetyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
acetyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-acetylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxobutanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxobutanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxobutanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxobutanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxobutanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxybutanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxybutanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxybutanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxybutanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxybutanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-butenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-butenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-butenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-butenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-butenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=butanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-butanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- butanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
butanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-butanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxohexanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxohexanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxohexanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxohexanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxohexanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxyhexanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyhexanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxyhexanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxyhexanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyhexanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-hexenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-hexenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-hexenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-hexenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-hexenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=hexanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-hexanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- H+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+hexanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-hexanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxooctanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxooctanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxooctanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxooctanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxooctanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxyoctanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyoctanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxyoctanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxyoctanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyoctanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-octenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-(2E)-octenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-octenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-octenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-(2E)-octenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+octanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-octanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+octanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-octanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxodecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxodecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxodecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxodecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxodecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxydecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxydecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxydecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxydecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxydecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-decenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-decenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-decenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-decenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-decenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=decanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-decanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- decanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
decanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-decanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxododecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxododecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxododecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxododecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxododecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxydodecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxydodecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxydodecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxydodecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxydodecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-dodecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-dodecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-dodecenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-dodecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-dodecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=dodecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
dodecanoyl-pantetheine-4-phosphoryl-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- dodecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
dodecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
dodecanoyl-pantetheine-4-phosphoryl-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxotetradecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxotetradecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxotetradecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxotetradecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxotetradecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxytetradecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxytetradecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxytetradecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxytetradecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxytetradecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-tetradecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-tetradecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-tetradecenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-tetradecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-tetradecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+tetradecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-tetradecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+tetradecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-tetradecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxohexadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxohexadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxohexadecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxohexadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxohexadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxyhexadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyhexadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxyhexadecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxyhexadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyhexadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-hexadecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-hexadecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-hexadecenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-hexadecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-hexadecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=hexadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-hexadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- H+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+hexadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-hexadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-malonylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=3-oxooctadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxooctadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 3-oxooctadecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
3-oxooctadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3-oxooctadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(3R)-hydroxyoctadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyoctadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- (3R)-hydroxyoctadecanoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(3R)-hydroxyoctadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-3R-hydroxyoctadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=(2E)-octadecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-octadecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (2E)-octadecenoyl-[ACP]
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(2E)-octadecenoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-2E-octadecenoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+NADPH- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=NADP+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+octadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-octadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H2OEC:3.1.2.14
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+tetradecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-tetradecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+tetradecanoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- H2O
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.30"Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain."
Chakravarty B., Gu Z., Chirala S.S., Wakil S.J., Quiocho F.A.
Proc. Natl. Acad. Sci. U.S.A. 101:15567-15572(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 2218-2502, CATALYTIC ACTIVITY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.30"Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain."
Chakravarty B., Gu Z., Chirala S.S., Wakil S.J., Quiocho F.A.
Proc. Natl. Acad. Sci. U.S.A. 101:15567-15572(2004) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 2218-2502, CATALYTIC ACTIVITY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+octadecanoyl-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(S-octadecanoylpantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+holo-[ACP]- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
O-(pantetheine-4ʼ-phosphoryl)-L-serine residuezoom- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+octadecanoate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi
Manual assertion based on experiment ini
- Ref.13"Fatty acid synthase: a novel target for antiglioma therapy."
Zhao W., Kridel S., Thorburn A., Kooshki M., Little J., Hebbar S., Robbins M.
Br. J. Cancer 95:869-878(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, ACTIVITY REGULATION. - Ref.14"S-nitrosylation of fatty acid synthase regulates its activity through dimerization."
Choi M.S., Jung J.Y., Kim H.J., Ham M.R., Lee T.R., Shin D.W.
J. Lipid Res. 57:607-615(2016) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, S-NITROSYLATION AT CYS-1471 AND CYS-2091.
<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi
- KM=8 µM for acetyl-CoA1 Publication
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
- KM=20 µM for malonyl-CoA1 Publication
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
- KM=25 µM for NADPH1 Publication
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
- KM=4 µM for butanoyl-CoA1 Publication
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
- KM=7 µM for acetyl-CoA1 Publication
Manual assertion based on experiment ini
- Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=6 µM for malonyl-CoA1 Publication
Manual assertion based on experiment ini
- Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=5 µM for NADPH1 Publication
Manual assertion based on experiment ini
- Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=29.6 nmol/min/mg enzyme for the incorporation of acetyl-CoA into fatty acids1 Publication
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
- Vmax=220.6 nmol/min/mg enzyme for the incorporation of malonyl-CoA into fatty acids1 Publication
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
- Vmax=462 nmol/min/mg enzyme for the oxidation of NADPH1 Publication
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
- Vmax=440 nmol/min/mg enzyme for the oxidation of NADPH (at pH 7.0)1 Publication
Manual assertion based on experiment ini
- Ref.12"Substrate recognition by the human fatty-acid synthase."
Carlisle-Moore L., Gordon C.R., Machutta C.A., Miller W.T., Tonge P.J.
J. Biol. Chem. 280:42612-42618(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
pH dependencei
Manual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: fatty acid biosynthesis
This protein is involved in the pathway fatty acid biosynthesis, which is part of Lipid metabolism.3 PublicationsManual assertion based on experiment ini
- Ref.1"Human fatty acid synthase: properties and molecular cloning."
Jayakumar A., Tai M.-H., Huang W.-Y., Al-Feel W., Hsu M., Abu-Elheiga L., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 92:8695-8699(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHOPANTETHEINYLATION AT SER-2156, TISSUE SPECIFICITY. - Ref.10"Cloning and expression of the multifunctional human fatty acid synthase and its subdomains in Escherichia coli."
Jayakumar A., Huang W.Y., Raetz B., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 93:14509-14514(1996) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY. - Ref.11"Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity."
Jayakumar A., Chirala S.S., Wakil S.J.
Proc. Natl. Acad. Sci. U.S.A. 94:12326-12330(1997) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY.
View all proteins of this organism that are known to be involved in the pathway fatty acid biosynthesis and in Lipid metabolism.
Sites
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei | 161 | For beta-ketoacyl synthase activityPROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi | 1 | |
Active sitei | 581 | For malonyltransferase activityPROSITE-ProRule annotation Manual assertion according to rulesi | 1 | |
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei | 671 | Acyl-CoABy similarity <p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi | 1 | |
Binding sitei | 773 | Acyl-CoABy similarity Manual assertion inferred from sequence similarity toi | 1 | |
Active sitei | 878 | For beta-hydroxyacyl dehydratase activityPROSITE-ProRule annotation Manual assertion according to rulesi | 1 | |
Active sitei | 2308 | For thioesterase activityPROSITE-ProRule annotation Manual assertion according to rulesi 1 PublicationManual assertion based on experiment ini
| 1 | |
Active sitei | 2481 | For thioesterase activityPROSITE-ProRule annotation Manual assertion according to rulesi | 1 |
Regions
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi | 1671 – 1688 | NADP (ER)By similarityAdd BLAST | 18 | |
Nucleotide bindingi | 1886 – 1901 | NADP (KR)By similarityAdd BLAST | 16 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase activity Source: UniProtKB-EC
- [acyl-carrier-protein] S-acetyltransferase activity Source: UniProtKB-EC
- [acyl-carrier-protein] S-malonyltransferase activity Source: UniProtKB-EC
- 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase activity Source: UniProtKB-EC
- 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity Source: UniProtKB-EC
- 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity Source: UniProtKB-EC
- 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity Source: UniProtKB-EC
- 3-oxoacyl-[acyl-carrier-protein] synthase activity Source: UniProtKB-EC
- 3-oxo-glutaryl-[acp] methyl ester reductase activity Source: UniProtKB-EC
- 3-oxo-pimeloyl-[acp] methyl ester reductase activity Source: UniProtKB-EC
- cadherin binding Source: BHF-UCLInferred from high throughput direct assayi
- "E-cadherin interactome complexity and robustness resolved by quantitative proteomics."
Guo Z., Neilson L.J., Zhong H., Murray P.S., Zanivan S., Zaidel-Bar R.
Sci Signal 7:rs7-rs7(2014) [PubMed] [Europe PMC] [Abstract]
- drug binding Source: Ensembl
- enoyl-[acyl-carrier-protein] reductase (NADPH, A-specific) activity Source: UniProtKB-EC
- identical protein binding Source: Ensembl
- myristoyl-[acyl-carrier-protein] hydrolase activity Source: UniProtKB-EC
- NADPH binding Source: Ensembl
- oleoyl-[acyl-carrier-protein] hydrolase activity Source: UniProtKB-EC
- palmitoyl-[acyl-carrier-protein] hydrolase activity Source: UniProtKB-EC
- phosphopantetheine binding Source: InterPro
- RNA binding Source: UniProtKBInferred from high throughput direct assayi
- "Insights into RNA biology from an atlas of mammalian mRNA-binding proteins."
Castello A., Fischer B., Eichelbaum K., Horos R., Beckmann B.M., Strein C., Davey N.E., Humphreys D.T., Preiss T., Steinmetz L.M., Krijgsveld J., Hentze M.W.
Cell 149:1393-1406(2012) [PubMed] [Europe PMC] [Abstract] - "The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts."
Baltz A.G., Munschauer M., Schwanhausser B., Vasile A., Murakawa Y., Schueler M., Youngs N., Penfold-Brown D., Drew K., Milek M., Wyler E., Bonneau R., Selbach M., Dieterich C., Landthaler M.
Mol Cell 46:674-690(2012) [PubMed] [Europe PMC] [Abstract]
GO - Biological processi
- acetyl-CoA metabolic process Source: Ensembl
- cellular response to interleukin-4 Source: Ensembl
- fatty acid biosynthetic process Source: UniProtKB-UniPathway
- fatty acid metabolic process Source: ProtInc
<p>Traceable Author Statement</p>
<p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#tas">GO evidence code guide</a></p>
Traceable author statementi
- "Isolation and chromosomal mapping of genomic clones encoding the human fatty acid synthase gene."
Jayakumar A., Chirala S.S., Chinault A.C., Baldini A., Abu-Elheiga L., Wakil S.J.
Genomics 23:420-424(1994) [PubMed] [Europe PMC] [Abstract]
- fatty-acyl-CoA biosynthetic process Source: Reactome
- mammary gland development Source: Ensembl
- osteoblast differentiation Source: UniProtKBInferred from high throughput direct assayi
- "Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation."
Foster L.J., Zeemann P.A., Li C., Mann M., Jensen O.N., Kassem M.
Stem Cells 23:1367-1377(2005) [PubMed] [Europe PMC] [Abstract]
- positive regulation of cellular metabolic process Source: Reactome
- regulation of cholesterol biosynthetic process Source: Reactome
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
Molecular function | Hydrolase, Lyase, Multifunctional enzyme, Oxidoreductase, Transferase |
Biological process | Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism |
Ligand | NAD, NADP, Pyridoxal phosphate |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | MetaCyc:HS09992-MONOMER |
BRENDA Comprehensive Enzyme Information System More...BRENDAi | 2.3.1.85, 2681 |
Pathway Commons web resource for biological pathway data More...PathwayCommonsi | P49327 |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-163765, ChREBP activates metabolic gene expression R-HSA-199220, Vitamin B5 (pantothenate) metabolism R-HSA-2426168, Activation of gene expression by SREBF (SREBP) R-HSA-75105, Fatty acyl-CoA biosynthesis R-HSA-9029558, NR1H2 & NR1H3 regulate gene expression linked to lipogenesis |
SABIO-RK: Biochemical Reaction Kinetics Database More...SABIO-RKi | P49327 |
SIGNOR Signaling Network Open Resource More...SIGNORi | P49327 |
UniPathway: a resource for the exploration and annotation of metabolic pathways More...UniPathwayi | UPA00094 |
Protein family/group databases
ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins More...ESTHERi | human-FASN, Thioesterase |
Chemistry databases
SwissLipids knowledge resource for lipid biology More...SwissLipidsi | SLP:000000765 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Fatty acid synthase (EC:2.3.1.85
Manual assertion based on experiment ini
Alternative name(s): Type I fatty acid synthase Including the following 7 domains: [Acyl-carrier-protein] S-acetyltransferase (EC:2.3.1.38
Manual assertion based on experiment ini
[Acyl-carrier-protein] S-malonyltransferase (EC:2.3.1.39
Manual assertion based on experiment ini
3-oxoacyl-[acyl-carrier-protein] synthase (EC:2.3.1.41
Manual assertion based on experiment ini
3-oxoacyl-[acyl-carrier-protein] reductase (EC:1.1.1.100
Manual assertion based on experiment ini
|