Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P49282 (NRAM2_MOUSE)

Entry version 164 (12 Aug 2020)
Sequence version 2 (22 Sep 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Natural resistance-associated macrophage protein 2

Gene

Slc11a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May serve to import iron into the mitochondria (By similarity). Important in metal transport, in particular iron. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution.By similarity2 Publications

Miscellaneous

Nifedipine induces duodenal iron accumulation and mobilizes iron from the liver of iron-overloaded mice.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Iron transport, Transport
LigandIron

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-425410, Metal ion SLC transporters
R-MMU-917937, Iron uptake and transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Natural resistance-associated macrophage protein 2
Short name:
NRAMP 2
Alternative name(s):
Divalent cation transporter 1
Divalent metal transporter 1
Short name:
DMT-1
Solute carrier family 11 member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc11a2
Synonyms:Dct1, Dmt1, Nramp2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1345279, Slc11a2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 69CytoplasmicSequence analysisAdd BLAST69
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei70 – 90HelicalSequence analysisAdd BLAST21
Topological domaini91 – 95ExtracellularSequence analysis5
Transmembranei96 – 117HelicalSequence analysisAdd BLAST22
Topological domaini118 – 154CytoplasmicSequence analysisAdd BLAST37
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 179ExtracellularSequence analysis4
Transmembranei180 – 194HelicalSequence analysisAdd BLAST15
Topological domaini195 – 208CytoplasmicSequence analysisAdd BLAST14
Transmembranei209 – 229HelicalSequence analysisAdd BLAST21
Topological domaini230 – 255ExtracellularSequence analysisAdd BLAST26
Transmembranei256 – 276HelicalSequence analysisAdd BLAST21
Topological domaini277 – 301CytoplasmicSequence analysisAdd BLAST25
Transmembranei302 – 322HelicalSequence analysisAdd BLAST21
Topological domaini323 – 360ExtracellularSequence analysisAdd BLAST38
Transmembranei361 – 381HelicalSequence analysisAdd BLAST21
Topological domaini382 – 408CytoplasmicSequence analysisAdd BLAST27
Transmembranei409 – 429HelicalSequence analysisAdd BLAST21
Topological domaini430 – 440ExtracellularSequence analysisAdd BLAST11
Transmembranei441 – 461HelicalSequence analysisAdd BLAST21
Topological domaini462 – 482CytoplasmicSequence analysisAdd BLAST21
Transmembranei483 – 503HelicalSequence analysisAdd BLAST21
Topological domaini504 – 506ExtracellularSequence analysis3
Transmembranei507 – 527HelicalSequence analysisAdd BLAST21
Topological domaini528 – 568CytoplasmicSequence analysisAdd BLAST41

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Slc11a2 are the cause of microcytic anemia (mk). Homozygous mk/mk mice have hypochromic microcytic anemia due to severe defects in intestinal iron absorption and erythroid iron utilization.

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice display no apparent anatomical abnormalities. They are however anemic, show progressive postnatal growth retardation, and at birth have elevated liver iron stores compared with wild-type littermates. None survive for more than 7 days. Heterozygotes appear normal, showing no significant hematological abnormalities. However, by 8 weeks, their liver iron content is lower than in wild-type littermates.1 Publication

Keywords - Diseasei

Disease mutation

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002125951 – 568Natural resistance-associated macrophage protein 2Add BLAST568

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi336N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi349N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei564PhosphoserineCombined sources1
Modified residuei567PhosphoserineCombined sources1
Isoform 1 (identifier: P49282-2)
Modified residuei556PhosphoserineCombined sources1
Isoform 3 (identifier: P49282-3)
Modified residuei586PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.By similarity
Ubiquitinated by WWP2.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P49282

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P49282

MaxQB - The MaxQuant DataBase

More...MaxQBi		P49282

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P49282

PeptideAtlas

More...PeptideAtlasi		P49282

PRoteomics IDEntifications database

More...PRIDEi		P49282

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P49282, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P49282

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P49282

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P49282

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is abundantly expressed in erythroid precursor cells (at protein level). Expressed at low levels in most tissues analyzed. Expressed at low levels in small intestine and at higher levels in kidney.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated under iron-depletion conditions in the proximal portion of the duodenum where it is abundantly expressed in the brush border of absorptive epithelial cells (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000023030, Expressed in cardiac ventricle and 283 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P49282, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P49282, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a complex with NDFIP1 and NEDD4L, in cortical neurons, in response to iron and colbalt exposure; this interaction leads to ubiquitination by NEDD4L and proteasome-dependent degradation.

Interacts with NDFIP2.

Interacts with COX2 and TOM6 at the outer mitochondrion membrane (By similarity).

Interacts with ARRDC1; controls the incorporation of SLC11A2 into extracellular vesicles through an ubiquitination-dependent mechanism (By similarity).

Interacts with ARRDC4; controls the incorporation of SLC11A2 into extracellular vesicles through an ubiquitination-dependent mechanism (PubMed:27462458).

By similarity1 Publication

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000023774

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P49282, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NRAMP family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1291, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155330

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_020088_5_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P49282

KEGG Orthology (KO)

More...KOi		K21398

Identification of Orthologs from Complete Genome Data

More...OMAi		LIQYQSA

Database of Orthologous Groups

More...OrthoDBi		666470at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P49282

TreeFam database of animal gene trees

More...TreeFami		TF315185

Family and domain databases

HAMAP database of protein families

More...HAMAPi		MF_00221, NRAMP, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001046, NRAMP_fam

The PANTHER Classification System

More...PANTHERi		PTHR11706, PTHR11706, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01566, Nramp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00447, NATRESASSCMP

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR01197, nramp, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P49282-1) [UniParc]FASTAAdd to basket
Also known as: Non-IRE

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLDPKEKMP DDGASGDHGD SASLGAINPA YSNSSLPHST GDSEEPFTTY 
        60         70         80         90        100
FDEKIPIPEE EYSCFSFRKL WAFTGPGFLM SIAYLDPGNI ESDLQSGAVA 
       110        120        130        140        150
GFKLLWVLLL ATIVGLLLQR LAARLGVVTG LHLAEVCHRQ YPKVPRIILW 
       160        170        180        190        200
LMVELAIIGS DMQEVIGSAI AINLLSAGRV PLWGGVLITI ADTFVFLFLD 
       210        220        230        240        250
KYGLRKLEAF FGFLITIMAL TFGYEYITVK PSQSQVLRGM FVPSCPGCRT 
       260        270        280        290        300
PQVEQAVGIV GAVIMPHNMY LHSALVKSRQ VNRANKQEVR EANKYFFIES 
       310        320        330        340        350
CIALFVSFII NVFVVSVFAE AFFEKTNKQV VEVCKNNSSP HADLFPSDNS 
       360        370        380        390        400
TLAVDIYKGG VVLGCYFGPA ALYIWAVGIL AAGQSSTMTG TYSGQFVMEG 
       410        420        430        440        450
FLNLKWSRFA RVILTRSIAI IPTLLVAVFQ DVEHLTGMND FLNVLQSLQL 
       460        470        480        490        500
PFALIPILTF TSLRPVMSEF SNGIGWRIAG GILVLIVCSI NMYFVVVYVQ 
       510        520        530        540        550
ELGHVALYVV AAVVSVAYLT FVFYLGWQCL IALGLSFLDC GRSYRLGLTA 
       560 
QPELYLLNTV DADSVVSR
Length:568
Mass (Da):62,368
Last modified:September 22, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i603AAF697AAD3C74
GO
Isoform 1 (identifier: P49282-2) [UniParc]FASTAAdd to basket
Also known as: IRE

The sequence of this isoform differs from the canonical sequence as follows:
     544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK

Show »
Length:561
Mass (Da):61,421
Checksum:iD2FAA52B8F73FFBC
GO
Isoform 3 (identifier: P49282-3) [UniParc]FASTAAdd to basket
Also known as: 1A-IRE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM
     544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK

Show »
Length:591
Mass (Da):64,568
Checksum:iF8119C955315B2F6
GO
Isoform 4 (identifier: P49282-4) [UniParc]FASTAAdd to basket
Also known as: 1A-Non-IRE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM

Show »
Length:598
Mass (Da):65,515
Checksum:iED4B62ED656BAEBE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z314D3Z314_MOUSE
Natural resistance-associated macro...
Slc11a2
170Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZM31F6ZM31_MOUSE
Natural resistance-associated macro...
Slc11a2
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z0R6D3Z0R6_MOUSE
Natural resistance-associated macro...
Slc11a2
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YXP3D3YXP3_MOUSE
Natural resistance-associated macro...
Slc11a2
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGP0D6RGP0_MOUSE
Natural resistance-associated macro...
Slc11a2
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD38518 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti6K → E in BAE28454 (PubMed:16141072).Curated1
Sequence conflicti6K → E in CAD38518 (PubMed:12209011).Curated1
Sequence conflicti68R → S in AAC24496 (Ref. 2) Curated1
Sequence conflicti69 – 70Missing in CAD38518 (PubMed:12209011).Curated2
Sequence conflicti142P → R in BAC38930 (PubMed:16141072).Curated1
Sequence conflicti182L → V in AAC42051 (PubMed:7789986).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti185G → R in microcytic anemia. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0381451M → MGKKQPRAAAAAPNCELKSY SKSTDPQVSTM in isoform 3 and isoform 4. Curated1
Alternative sequenceiVSP_003596544 – 568YRLGL…SVVSR → VSISKVLLSEDTSGGNIK in isoform 1 and isoform 3. 2 PublicationsAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L33415 mRNA Translation: AAC42051.1
AF029758 mRNA Translation: AAC24496.1
AK049856 mRNA Translation: BAC33960.1
AK083478 mRNA Translation: BAC38930.1
AK148276 mRNA Translation: BAE28454.1
CH466550 Genomic DNA Translation: EDL04090.1
BC019137 mRNA Translation: AAH19137.1
AJ493663 mRNA Translation: CAD38518.1 Frameshift.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS37211.1 [P49282-1]
CCDS49733.1 [P49282-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A56852

NCBI Reference Sequences

More...RefSeqi		NP_001139633.1, NM_001146161.1 [P49282-2]
NP_032758.2, NM_008732.2 [P49282-1]
XP_006520640.1, XM_006520577.3 [P49282-1]
XP_006520641.1, XM_006520578.3 [P49282-1]
XP_011243789.1, XM_011245487.2 [P49282-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000023774; ENSMUSP00000023774; ENSMUSG00000023030 [P49282-1]
ENSMUST00000138843; ENSMUSP00000116463; ENSMUSG00000023030 [P49282-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		18174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:18174

UCSC genome browser

More...UCSCi		uc007xrc.2, mouse [P49282-1]
uc007xrd.2, mouse [P49282-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L33415 mRNA Translation: AAC42051.1
AF029758 mRNA Translation: AAC24496.1
AK049856 mRNA Translation: BAC33960.1
AK083478 mRNA Translation: BAC38930.1
AK148276 mRNA Translation: BAE28454.1
CH466550 Genomic DNA Translation: EDL04090.1
BC019137 mRNA Translation: AAH19137.1
AJ493663 mRNA Translation: CAD38518.1 Frameshift.
CCDSiCCDS37211.1 [P49282-1]
CCDS49733.1 [P49282-2]
PIRiA56852
RefSeqiNP_001139633.1, NM_001146161.1 [P49282-2]
NP_032758.2, NM_008732.2 [P49282-1]
XP_006520640.1, XM_006520577.3 [P49282-1]
XP_006520641.1, XM_006520578.3 [P49282-1]
XP_011243789.1, XM_011245487.2 [P49282-4]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000023774

PTM databases

GlyGeniP49282, 2 sites
iPTMnetiP49282
PhosphoSitePlusiP49282
SwissPalmiP49282

Proteomic databases

EPDiP49282
jPOSTiP49282
MaxQBiP49282
PaxDbiP49282
PeptideAtlasiP49282
PRIDEiP49282

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		26282, 357 antibodies

Genome annotation databases

EnsembliENSMUST00000023774; ENSMUSP00000023774; ENSMUSG00000023030 [P49282-1]
ENSMUST00000138843; ENSMUSP00000116463; ENSMUSG00000023030 [P49282-2]
GeneIDi18174
KEGGimmu:18174
UCSCiuc007xrc.2, mouse [P49282-1]
uc007xrd.2, mouse [P49282-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4891
MGIiMGI:1345279, Slc11a2

Phylogenomic databases

eggNOGiKOG1291, Eukaryota
GeneTreeiENSGT00940000155330
HOGENOMiCLU_020088_5_2_1
InParanoidiP49282
KOiK21398
OMAiLIQYQSA
OrthoDBi666470at2759
PhylomeDBiP49282
TreeFamiTF315185

Enzyme and pathway databases

ReactomeiR-MMU-425410, Metal ion SLC transporters
R-MMU-917937, Iron uptake and transport

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		18174, 0 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Slc11a2, mouse

Protein Ontology

More...PROi		PR:P49282
RNActiP49282, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000023030, Expressed in cardiac ventricle and 283 other tissues
ExpressionAtlasiP49282, baseline and differential
GenevisibleiP49282, MM

Family and domain databases

HAMAPiMF_00221, NRAMP, 1 hit
InterProiView protein in InterPro
IPR001046, NRAMP_fam
PANTHERiPTHR11706, PTHR11706, 1 hit
PfamiView protein in Pfam
PF01566, Nramp, 1 hit
PRINTSiPR00447, NATRESASSCMP
TIGRFAMsiTIGR01197, nramp, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRAM2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49282
Secondary accession number(s): O54903
, Q3UFV5, Q8BJL2, Q8BWV3, Q8CFA0, Q8VCU6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: September 22, 2009
Last modified: August 12, 2020
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again