Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - P49281 (NRAM2_HUMAN)

Entry version 196 (23 Feb 2022)
Sequence version 2 (30 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Natural resistance-associated macrophage protein 2

Gene

SLC11A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Important in metal transport, in particular iron. Can also transport manganese, cobalt, cadmium, nickel, vanadium and lead. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution. May serve to import iron into the mitochondria.

4 Publications

Miscellaneous

NRAMP2-mediated iron uptake is markedly stimulated by nifedipine in a concentration-dependent manner.

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>pH dependencei

Optimum pH is 5.5-6.5 for Fe2+ uptake.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Iron transport, Transport
LigandIron

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P49281

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-425410, Metal ion SLC transporters
R-HSA-5619048, Defective SLC11A2 causes hypochromic microcytic anemia, with iron overload 1 (AHMIO1)
R-HSA-917937, Iron uptake and transport

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P49281

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.55.2.1, the metal ion (mn(2+)-iron) transporter (nramp) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Natural resistance-associated macrophage protein 2
Short name:
NRAMP 2
Alternative name(s):
Divalent cation transporter 1
Divalent metal transporter 1
Short name:
DMT-1
Solute carrier family 11 member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC11A2
Synonyms:DCT1, DMT1, NRAMP2
ORF Names:OK/SW-cl.20
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10908, SLC11A2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600523, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P49281

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000110911

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 69CytoplasmicSequence analysisAdd BLAST69
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei70 – 90HelicalSequence analysisAdd BLAST21
Topological domaini91 – 96ExtracellularSequence analysis6
Transmembranei97 – 117HelicalSequence analysisAdd BLAST21
Topological domaini118 – 154CytoplasmicSequence analysisAdd BLAST37
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 179ExtracellularSequence analysis4
Transmembranei180 – 200HelicalSequence analysisAdd BLAST21
Topological domaini201 – 208CytoplasmicSequence analysis8
Transmembranei209 – 229HelicalSequence analysisAdd BLAST21
Topological domaini230 – 255ExtracellularSequence analysisAdd BLAST26
Transmembranei256 – 276HelicalSequence analysisAdd BLAST21
Topological domaini277 – 301CytoplasmicSequence analysisAdd BLAST25
Transmembranei302 – 322HelicalSequence analysisAdd BLAST21
Topological domaini323 – 360ExtracellularSequence analysisAdd BLAST38
Transmembranei361 – 381HelicalSequence analysisAdd BLAST21
Topological domaini382 – 408CytoplasmicSequence analysisAdd BLAST27
Transmembranei409 – 429HelicalSequence analysisAdd BLAST21
Topological domaini430 – 440ExtracellularSequence analysisAdd BLAST11
Transmembranei441 – 461HelicalSequence analysisAdd BLAST21
Topological domaini462 – 482CytoplasmicSequence analysisAdd BLAST21
Transmembranei483 – 503HelicalSequence analysisAdd BLAST21
Topological domaini504 – 506ExtracellularSequence analysis3
Transmembranei507 – 527HelicalSequence analysisAdd BLAST21
Topological domaini528 – 568CytoplasmicSequence analysisAdd BLAST41

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Anemia, hypochromic microcytic, with iron overload 1 (AHMIO1)3 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA hematologic disease characterized by abnormal hemoglobin content in the erythrocytes which are reduced in size. The disorder is due to an error of iron metabolism that results in high serum iron, massive hepatic iron deposition, and absence of sideroblasts and stainable bone marrow iron store. Despite adequate transferrin-iron complex, delivery of iron to the erythroid bone marrow is apparently insufficient for the demands of hemoglobin synthesis.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033011114Missing in AHMIO1. 1 Publication1
Natural variantiVAR_033012212G → V in AHMIO1. 1 PublicationCorresponds to variant dbSNP:rs121918367EnsemblClinVar.1
Natural variantiVAR_033013399E → D in AHMIO1; increased skipping of exon 12. 1 PublicationCorresponds to variant dbSNP:rs121918365EnsemblClinVar.1
Natural variantiVAR_033014416R → C in AHMIO1. 1 PublicationCorresponds to variant dbSNP:rs121918366EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi86D → A: Abolishes ion transport across the cell membrane. 1 Publication1
Mutagenesisi89N → A: Decreases affinity for divalent metal cations. Impairs ion transport across the cell membrane. 1 Publication1
Mutagenesisi265M → A: Abolishes ion transport across the cell membrane. 1 Publication1
Mutagenesisi555Y → A: Abolishes localization at early endosomes and leads to localization at late endosomes and lysosomes. 1 Publication1
Mutagenesisi557L → A: Abolishes localization at early endosomes and leads to localization at late endosomes and lysosomes. 1 Publication1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		4891

MalaCards human disease database

More...MalaCardsi		SLC11A2
MIMi206100, phenotype

Open Targets

More...OpenTargetsi		ENSG00000110911

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		83642, Microcytic anemia with liver iron overload

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA259

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P49281, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1932895

Drug and drug target database

More...DrugBanki		DB09130, Copper
DB15598, Ferric maltol
DB13257, Ferrous sulfate anhydrous
DB06796, Mangafodipir
DB14520, Tetraferric tricitrate decahydrate

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		967

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLC11A2

Domain mapping of disease mutations (DMDM)

More...DMDMi		8247934

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002125941 – 568Natural resistance-associated macrophage protein 2Add BLAST568

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi336N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi349N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei564PhosphoserineBy similarity1
Modified residuei567PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by WWP2.By similarity
N-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P49281

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P49281

MaxQB - The MaxQuant DataBase

More...MaxQBi		P49281

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P49281

PeptideAtlas

More...PeptideAtlasi		P49281

PRoteomics IDEntifications database

More...PRIDEi		P49281

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		27377
55979 [P49281-1]
55980 [P49281-2]
55981 [P49281-3]
55982 [P49281-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P49281, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P49281

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P49281

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P49281

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Isoform 1 is highly expressed in brain. Isoform 2 is highly expressed in spleen, thymus and pancreas. Isoform 3 and isoform 4 are abundantly expressed in duodenum and kidney.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000110911, Expressed in colon and 250 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P49281, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P49281, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000110911, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a complex with NDFIP1 and NEDD4L, in cortical neurons, in response to iron and colbalt exposure; this interaction leads to ubiquitination by NEDD4L and proteasome-dependent degradation.

Interacts with NDFIP2.

Interacts with COX2 and TOM6 at the outer mitochondrion membrane.

Interacts with ARRDC1; controls the incorporation of SLC11A2 into extracellular vesicles through an ubiquitination-dependent mechanism (PubMed:27462458).

Interacts with ARRDC4; controls the incorporation of SLC11A2 into extracellular vesicles through an ubiquitination-dependent mechanism (By similarity).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110950, 23 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P49281

Database of interacting proteins

More...DIPi		DIP-48957N

Protein interaction database and analysis system

More...IntActi		P49281, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000378364

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P49281

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P49281, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1568
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P49281

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 40DisorderedSequence analysisAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi16 – 40Polar residuesSequence analysisAdd BLAST25

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NRAMP family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1291, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155330

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P49281

Identification of Orthologs from Complete Genome Data

More...OMAi		ENDAPWL

Database of Orthologous Groups

More...OrthoDBi		666470at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P49281

TreeFam database of animal gene trees

More...TreeFami		TF315185

Family and domain databases

HAMAP database of protein families

More...HAMAPi		MF_00221, NRAMP, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001046, NRAMP_fam

The PANTHER Classification System

More...PANTHERi		PTHR11706, PTHR11706, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01566, Nramp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00447, NATRESASSCMP

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR01197, nramp, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P49281-1) [UniParc]FASTAAdd to basket
Also known as: Non-IRE, DMT1B

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLGPEQKMS DDSVSGDHGE SASLGNINPA YSNPSLSQSP GDSEEYFATY 
        60         70         80         90        100
FNEKISIPEE EYSCFSFRKL WAFTGPGFLM SIAYLDPGNI ESDLQSGAVA 
       110        120        130        140        150
GFKLLWILLL ATLVGLLLQR LAARLGVVTG LHLAEVCHRQ YPKVPRVILW 
       160        170        180        190        200
LMVELAIIGS DMQEVIGSAI AINLLSVGRI PLWGGVLITI ADTFVFLFLD 
       210        220        230        240        250
KYGLRKLEAF FGFLITIMAL TFGYEYVTVK PSQSQVLKGM FVPSCSGCRT 
       260        270        280        290        300
PQIEQAVGIV GAVIMPHNMY LHSALVKSRQ VNRNNKQEVR EANKYFFIES 
       310        320        330        340        350
CIALFVSFII NVFVVSVFAE AFFGKTNEQV VEVCTNTSSP HAGLFPKDNS 
       360        370        380        390        400
TLAVDIYKGG VVLGCYFGPA ALYIWAVGIL AAGQSSTMTG TYSGQFVMEG 
       410        420        430        440        450
FLNLKWSRFA RVVLTRSIAI IPTLLVAVFQ DVEHLTGMND FLNVLQSLQL 
       460        470        480        490        500
PFALIPILTF TSLRPVMSDF ANGLGWRIAG GILVLIICSI NMYFVVVYVR 
       510        520        530        540        550
DLGHVALYVV AAVVSVAYLG FVFYLGWQCL IALGMSFLDC GHTCHLGLTA 
       560 
QPELYLLNTM DADSLVSR
Length:568
Mass (Da):62,266
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4E45D6A448A23263
GO
Isoform 1 (identifier: P49281-2) [UniParc]FASTAAdd to basket
Also known as: IRE

The sequence of this isoform differs from the canonical sequence as follows:
     544-568: CHLGLTAQPELYLLNTMDADSLVSR → VSISKGLLTEEATRGYVK

Show »
Length:561
Mass (Da):61,456
Checksum:i30020C1DDDF2F8AA
GO
Isoform 3 (identifier: P49281-3) [UniParc]FASTAAdd to basket
Also known as: 1A-IRE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRKKQLKTEAAPHCELKSYSKNSATQVSTM
     544-568: CHLGLTAQPELYLLNTMDADSLVSR → VSISKGLLTEEATRGYVK

Show »
Length:590
Mass (Da):64,704
Checksum:iE3519A0770B89737
GO
Isoform 4 (identifier: P49281-4) [UniParc]FASTAAdd to basket
Also known as: 1A-Non-IRE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRKKQLKTEAAPHCELKSYSKNSATQVSTM

Show »
Length:597
Mass (Da):65,514
Checksum:i3B5363A0DA116B40
GO
Isoform 5 (identifier: P49281-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MVLGPEQKMSDD → MSTVDYLN
     544-568: CHLGLTAQPELYLLNTMDADSLVSR → VSISKGLLTEEATRGYVK

Show »
Length:557
Mass (Da):61,048
Checksum:iFF774A7FDD434B25
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W1P7F8W1P7_HUMAN
Natural resistance-associated macro...
SLC11A2
482Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VR36F8VR36_HUMAN
Natural resistance-associated macro...
SLC11A2
153Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VWB0F8VWB0_HUMAN
Natural resistance-associated macro...
SLC11A2
149Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YD71A0A2R8YD71_HUMAN
Natural resistance-associated macro...
SLC11A2
573Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5L1A0A2R8Y5L1_HUMAN
Natural resistance-associated macro...
SLC11A2
126Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y4F9A0A2R8Y4F9_HUMAN
Natural resistance-associated macro...
SLC11A2
253Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YDL2A0A2R8YDL2_HUMAN
Natural resistance-associated macro...
SLC11A2
161Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1C0F8W1C0_HUMAN
Natural resistance-associated macro...
SLC11A2
147Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1F2F8W1F2_HUMAN
Natural resistance-associated macro...
SLC11A2
150Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W154F8W154_HUMAN
Natural resistance-associated macro...
SLC11A2
98Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH02592 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA34374 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti58 – 59PE → GM in AAA79219 (PubMed:7613023).Curated2
Sequence conflicti81S → T in AAA79219 (PubMed:7613023).Curated1
Sequence conflicti119Q → K in AAI00015 (PubMed:15489334).Curated1
Sequence conflicti124R → K in AAA79219 (PubMed:7613023).Curated1
Sequence conflicti462 – 463SL → YV in AAA79219 (PubMed:7613023).Curated2
Sequence conflicti476W → C in AAA79219 (PubMed:7613023).Curated1
Isoform 5 (identifier: P49281-5)
Sequence conflicti6Y → S in BAG59096 (PubMed:14702039).Curated1
Sequence conflicti6Y → S in BAH14878 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03643448A → T in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs760028045Ensembl.1
Natural variantiVAR_033011114Missing in AHMIO1. 1 Publication1
Natural variantiVAR_033012212G → V in AHMIO1. 1 PublicationCorresponds to variant dbSNP:rs121918367EnsemblClinVar.1
Natural variantiVAR_033013399E → D in AHMIO1; increased skipping of exon 12. 1 PublicationCorresponds to variant dbSNP:rs121918365EnsemblClinVar.1
Natural variantiVAR_033014416R → C in AHMIO1. 1 PublicationCorresponds to variant dbSNP:rs121918366EnsemblClinVar.1
Natural variantiVAR_008882435L → I1 PublicationCorresponds to variant dbSNP:rs144863268EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0460581 – 12MVLGP…KMSDD → MSTVDYLN in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_0381441M → MRKKQLKTEAAPHCELKSYS KNSATQVSTM in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_003595544 – 568CHLGL…SLVSR → VSISKGLLTEEATRGYVK in isoform 1, isoform 3 and isoform 5. 6 PublicationsAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB004857 mRNA Translation: BAA24933.1
AB015355 Genomic DNA Translation: BAA34374.1 Sequence problems.
AF064482 AF064481 Genomic DNA Translation: AAC21460.1
AF064483 AF064482 Genomic DNA Translation: AAC21461.1
AF064484 mRNA Translation: AAC21459.1
AJ493662 mRNA Translation: CAD38517.1
AF046997 mRNA Translation: AAC18078.1
AK094735 mRNA Translation: BAG52920.1
AK296445 mRNA Translation: BAG59096.1
AK316507 mRNA Translation: BAH14878.1
AB062284 mRNA Translation: BAB93467.1
AC087884 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58159.1
BC002592 mRNA Translation: AAH02592.1 Different initiation.
BC100014 mRNA Translation: AAI00015.1
L37347 mRNA Translation: AAA79219.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53791.1 [P49281-5]
CCDS53792.1 [P49281-1]
CCDS53793.1 [P49281-3]
CCDS8805.1 [P49281-2]

Protein sequence database of the Protein Information Resource

More...PIRi		I57022

NCBI Reference Sequences

More...RefSeqi		NP_000608.1, NM_000617.2 [P49281-2]
NP_001167596.1, NM_001174125.1 [P49281-3]
NP_001167597.1, NM_001174126.1 [P49281-1]
NP_001167598.1, NM_001174127.1 [P49281-1]
NP_001167599.1, NM_001174128.1 [P49281-2]
NP_001167600.1, NM_001174129.1 [P49281-2]
NP_001167601.1, NM_001174130.1 [P49281-5]
XP_005268968.1, XM_005268911.3
XP_011536706.1, XM_011538404.2 [P49281-1]
XP_011536707.1, XM_011538405.2 [P49281-1]
XP_016874844.1, XM_017019355.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000262052; ENSP00000262052; ENSG00000110911 [P49281-2]
ENST00000394904; ENSP00000378364; ENSG00000110911 [P49281-3]
ENST00000541174; ENSP00000444542; ENSG00000110911 [P49281-2]
ENST00000545993; ENSP00000442810; ENSG00000110911 [P49281-5]
ENST00000546636; ENSP00000449008; ENSG00000110911
ENST00000547198; ENSP00000446769; ENSG00000110911
ENST00000547688; ENSP00000449200; ENSG00000110911 [P49281-4]
ENST00000644495; ENSP00000494107; ENSG00000110911

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4891

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4891

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000262052.9; ENSP00000262052.5; NM_000617.3; NP_000608.1 [P49281-2]

UCSC genome browser

More...UCSCi		uc001rxc.5, human [P49281-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB004857 mRNA Translation: BAA24933.1
AB015355 Genomic DNA Translation: BAA34374.1 Sequence problems.
AF064482 AF064481 Genomic DNA Translation: AAC21460.1
AF064483 AF064482 Genomic DNA Translation: AAC21461.1
AF064484 mRNA Translation: AAC21459.1
AJ493662 mRNA Translation: CAD38517.1
AF046997 mRNA Translation: AAC18078.1
AK094735 mRNA Translation: BAG52920.1
AK296445 mRNA Translation: BAG59096.1
AK316507 mRNA Translation: BAH14878.1
AB062284 mRNA Translation: BAB93467.1
AC087884 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58159.1
BC002592 mRNA Translation: AAH02592.1 Different initiation.
BC100014 mRNA Translation: AAI00015.1
L37347 mRNA Translation: AAA79219.1
CCDSiCCDS53791.1 [P49281-5]
CCDS53792.1 [P49281-1]
CCDS53793.1 [P49281-3]
CCDS8805.1 [P49281-2]
PIRiI57022
RefSeqiNP_000608.1, NM_000617.2 [P49281-2]
NP_001167596.1, NM_001174125.1 [P49281-3]
NP_001167597.1, NM_001174126.1 [P49281-1]
NP_001167598.1, NM_001174127.1 [P49281-1]
NP_001167599.1, NM_001174128.1 [P49281-2]
NP_001167600.1, NM_001174129.1 [P49281-2]
NP_001167601.1, NM_001174130.1 [P49281-5]
XP_005268968.1, XM_005268911.3
XP_011536706.1, XM_011538404.2 [P49281-1]
XP_011536707.1, XM_011538405.2 [P49281-1]
XP_016874844.1, XM_017019355.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5F0LX-ray3.20D545-568[»]
5F0MX-ray3.10D549-560[»]
5F0PX-ray2.78D549-560[»]
7BLOelectron microscopy9.50H/N551-560[»]
7BLQelectron microscopy9.20U/V551-560[»]
SMRiP49281
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110950, 23 interactors
CORUMiP49281
DIPiDIP-48957N
IntActiP49281, 6 interactors
STRINGi9606.ENSP00000378364

Chemistry databases

BindingDBiP49281
ChEMBLiCHEMBL1932895
DrugBankiDB09130, Copper
DB15598, Ferric maltol
DB13257, Ferrous sulfate anhydrous
DB06796, Mangafodipir
DB14520, Tetraferric tricitrate decahydrate
GuidetoPHARMACOLOGYi967

Protein family/group databases

TCDBi2.A.55.2.1, the metal ion (mn(2+)-iron) transporter (nramp) family

PTM databases

GlyGeniP49281, 2 sites
iPTMnetiP49281
PhosphoSitePlusiP49281
SwissPalmiP49281

Genetic variation databases

BioMutaiSLC11A2
DMDMi8247934

Proteomic databases

jPOSTiP49281
MassIVEiP49281
MaxQBiP49281
PaxDbiP49281
PeptideAtlasiP49281
PRIDEiP49281
ProteomicsDBi27377
55979 [P49281-1]
55980 [P49281-2]
55981 [P49281-3]
55982 [P49281-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		26282, 375 antibodies from 31 providers

The DNASU plasmid repository

More...DNASUi		4891

Genome annotation databases

EnsembliENST00000262052; ENSP00000262052; ENSG00000110911 [P49281-2]
ENST00000394904; ENSP00000378364; ENSG00000110911 [P49281-3]
ENST00000541174; ENSP00000444542; ENSG00000110911 [P49281-2]
ENST00000545993; ENSP00000442810; ENSG00000110911 [P49281-5]
ENST00000546636; ENSP00000449008; ENSG00000110911
ENST00000547198; ENSP00000446769; ENSG00000110911
ENST00000547688; ENSP00000449200; ENSG00000110911 [P49281-4]
ENST00000644495; ENSP00000494107; ENSG00000110911
GeneIDi4891
KEGGihsa:4891
MANE-SelectiENST00000262052.9; ENSP00000262052.5; NM_000617.3; NP_000608.1 [P49281-2]
UCSCiuc001rxc.5, human [P49281-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4891
DisGeNETi4891

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLC11A2
HGNCiHGNC:10908, SLC11A2
HPAiENSG00000110911, Low tissue specificity
MalaCardsiSLC11A2
MIMi206100, phenotype
600523, gene
neXtProtiNX_P49281
OpenTargetsiENSG00000110911
Orphaneti83642, Microcytic anemia with liver iron overload
PharmGKBiPA259
VEuPathDBiHostDB:ENSG00000110911

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1291, Eukaryota
GeneTreeiENSGT00940000155330
InParanoidiP49281
OMAiENDAPWL
OrthoDBi666470at2759
PhylomeDBiP49281
TreeFamiTF315185

Enzyme and pathway databases

PathwayCommonsiP49281
ReactomeiR-HSA-425410, Metal ion SLC transporters
R-HSA-5619048, Defective SLC11A2 causes hypochromic microcytic anemia, with iron overload 1 (AHMIO1)
R-HSA-917937, Iron uptake and transport
SignaLinkiP49281

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4891, 9 hits in 1059 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLC11A2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		DMT1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4891
PharosiP49281, Tchem

Protein Ontology

More...PROi		PR:P49281
RNActiP49281, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000110911, Expressed in colon and 250 other tissues
ExpressionAtlasiP49281, baseline and differential
GenevisibleiP49281, HS

Family and domain databases

HAMAPiMF_00221, NRAMP, 1 hit
InterProiView protein in InterPro
IPR001046, NRAMP_fam
PANTHERiPTHR11706, PTHR11706, 1 hit
PfamiView protein in Pfam
PF01566, Nramp, 1 hit
PRINTSiPR00447, NATRESASSCMP
TIGRFAMsiTIGR01197, nramp, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRAM2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49281
Secondary accession number(s): B3KT08
, B4DK84, F5H741, O43288, O60932, O94801, Q498Z5, Q8IUD7, Q96J35
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: May 30, 2000
Last modified: February 23, 2022
This is version 196 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again