Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (10 Apr 2019)
Sequence version 1 (01 Feb 1996)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

CX3C chemokine receptor 1

Gene

CX3CR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for the CX3C chemokine fractalkine (CX3CL1); binds to CX3CL1 and mediates both its adhesive and migratory functions (PubMed:9390561, PubMed:23125415). Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro) (PubMed:9726990). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1 (PubMed:14607932).4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
Biological processHost-virus interaction

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-380108 Chemokine receptors bind chemokines
R-HSA-418594 G alpha (i) signalling events

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P49238

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CX3C chemokine receptor 1
Short name:
C-X3-C CKR-1
Short name:
CX3CR1
Alternative name(s):
Beta chemokine receptor-like 1
CMK-BRL-1
Short name:
CMK-BRL1
Fractalkine receptor
G-protein coupled receptor 13
V28
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CX3CR1
Synonyms:CMKBRL1, GPR13
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000168329.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2558 CX3CR1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601470 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P49238

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 31ExtracellularSequence analysisAdd BLAST31
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei32 – 59Helical; Name=1Sequence analysisAdd BLAST28
Topological domaini60 – 69CytoplasmicSequence analysis10
Transmembranei70 – 90Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini91 – 103ExtracellularSequence analysisAdd BLAST13
Transmembranei104 – 125Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini126 – 142CytoplasmicSequence analysisAdd BLAST17
Transmembranei143 – 167Helical; Name=4Sequence analysisAdd BLAST25
Topological domaini168 – 195ExtracellularSequence analysisAdd BLAST28
Transmembranei196 – 215Helical; Name=5Sequence analysisAdd BLAST20
Topological domaini216 – 231CytoplasmicSequence analysisAdd BLAST16
Transmembranei232 – 256Helical; Name=6Sequence analysisAdd BLAST25
Topological domaini257 – 273ExtracellularSequence analysisAdd BLAST17
Transmembranei274 – 297Helical; Name=7Sequence analysisAdd BLAST24
Topological domaini298 – 355CytoplasmicSequence analysisAdd BLAST58

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Macular degeneration, age-related, 12 (ARMD12)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane.
See also OMIM:613784

Keywords - Diseasei

Age-related macular degeneration

Organism-specific databases

DisGeNET

More...
DisGeNETi
1524

MalaCards human disease database

More...
MalaCardsi
CX3CR1
MIMi609423 phenotype
613784 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000168329

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
279 NON RARE IN EUROPE: Age-related macular degeneration

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27054

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4843

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
74

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CX3CR1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1351394

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000693261 – 355CX3C chemokine receptor 1Add BLAST355

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi102 ↔ 175PROSITE-ProRule annotation
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei346PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

This protein is not N-glycosylated which is unusual for G-protein-coupled receptors.By similarity

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P49238

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P49238

PeptideAtlas

More...
PeptideAtlasi
P49238

PRoteomics IDEntifications database

More...
PRIDEi
P49238

ProteomicsDB human proteome resource

More...
ProteomicsDBi
55973
55974 [P49238-2]
55975 [P49238-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P49238

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P49238

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in lymphoid and neural tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168329 Expressed in 208 organ(s), highest expression level in mononuclear cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P49238 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P49238 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB032478
HPA030311
HPA046587
HPA077743

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a ternary complex with CX3CL1 and ITGAV:ITGB3 or ITGA4:ITGB1.1 Publication
(Microbial infection) Interacts with human respiratory syncytial virus (HRSV) protein G; this interaction modulates host immune response.1 Publication
(Microbial infection) Interacts with HIV-1 envelope polyprotein gp160.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107904, 1 interactor

Database of interacting proteins

More...
DIPi
DIP-5879N

Protein interaction database and analysis system

More...
IntActi
P49238, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000351059

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P49238

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P49238

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGZ8 Eukaryota
ENOG41118PP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182621

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234122

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106917

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P49238

KEGG Orthology (KO)

More...
KOi
K04192

Identification of Orthologs from Complete Genome Data

More...
OMAi
PFWTHYV

Database of Orthologous Groups

More...
OrthoDBi
665362at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P49238

TreeFam database of animal gene trees

More...
TreeFami
TF330966

Family and domain databases

Conserved Domains Database

More...
CDDi
cd15186 7tmA_CX3CR1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005387 Chemokine_CX3CR1
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01562 FRACTALKINER
PR00237 GPCRRHODOPSN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P49238-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDQFPESVTE NFEYDDLAEA CYIGDIVVFG TVFLSIFYSV IFAIGLVGNL
60 70 80 90 100
LVVFALTNSK KPKSVTDIYL LNLALSDLLF VATLPFWTHY LINEKGLHNA
110 120 130 140 150
MCKFTTAFFF IGFFGSIFFI TVISIDRYLA IVLAANSMNN RTVQHGVTIS
160 170 180 190 200
LGVWAAAILV AAPQFMFTKQ KENECLGDYP EVLQEIWPVL RNVETNFLGF
210 220 230 240 250
LLPLLIMSYC YFRIIQTLFS CKNHKKAKAI KLILLVVIVF FLFWTPYNVM
260 270 280 290 300
IFLETLKLYD FFPSCDMRKD LRLALSVTET VAFSHCCLNP LIYAFAGEKF
310 320 330 340 350
RRYLYHLYGK CLAVLCGRSV HVDFSSSESQ RSRHGSVLSS NFTYHTSDGD

ALLLL
Length:355
Mass (Da):40,396
Last modified:February 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC59DC5F4C4312F22
GO
Isoform 2 (identifier: P49238-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPLEALKLADLDFRKSSLASGWRMASGAFTM

Show »
Length:387
Mass (Da):43,935
Checksum:i446834BF5BF0FC5B
GO
Isoform 3 (identifier: P49238-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGAFTM

Show »
Length:362
Mass (Da):41,062
Checksum:i193A12DC884FC41B
GO
Isoform 4 (identifier: P49238-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPLEAFKLADLDFRKSSLASGWRMASGAFTM

Note: No experimental confirmation available.Curated
Show »
Length:387
Mass (Da):43,969
Checksum:iA90DFBDE74941C59
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JN40C9JN40_HUMAN
CX3C chemokine receptor 1
CX3CR1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLM2C9JLM2_HUMAN
CX3C chemokine receptor 1
CX3CR1
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 4 (identifier: P49238-4)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8F → L in DA413545 (PubMed:14702039).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Variations in CX3CR1 are associated with rapid progression to AIDS [MIMi:609423]. Increased susceptibility to HIV infection and rapid progression to AIDS are associated with the Ile-249/Met-280 haplotype.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04938613E → D1 PublicationCorresponds to variant dbSNP:rs41535248Ensembl.1
Natural variantiVAR_01004157T → A1 PublicationCorresponds to variant dbSNP:rs199811198Ensembl.1
Natural variantiVAR_010042122V → I1 PublicationCorresponds to variant dbSNP:rs143001773Ensembl.1
Natural variantiVAR_022062147V → I. Corresponds to variant dbSNP:rs3732380Ensembl.1
Natural variantiVAR_010043249V → I Common polymorphism in Caucasian population; associated with a markedly reduced risk of acute coronary artery disease; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Ile-249 and Met-280 genotypes is impaired in the presence of bound CX3CR1 protein. 6 PublicationsCorresponds to variant dbSNP:rs3732379Ensembl.1
Natural variantiVAR_010044280T → M Common polymorphism in Caucasian population; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Met-280 and Ile-249 genotypes is impaired in the presence of bound CX3CR1 protein. 5 PublicationsCorresponds to variant dbSNP:rs3732378Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0096811M → MREPLEALKLADLDFRKSSL ASGWRMASGAFTM in isoform 2. Curated1
Alternative sequenceiVSP_0096821M → MASGAFTM in isoform 3. Curated1
Alternative sequenceiVSP_0445951M → MREPLEAFKLADLDFRKSSL ASGWRMASGAFTM in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U20350 mRNA Translation: AAA91783.1
U28934 mRNA Translation: AAA87032.1
AY016370 Genomic DNA Translation: AAK08627.1
AK312373 mRNA Translation: BAG35291.1
DA413545 mRNA No translation available.
EF064744 Genomic DNA Translation: ABK41927.1
EU006531 Genomic DNA Translation: ABS29268.1
AC092053 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64576.1
BC028078 mRNA Translation: AAH28078.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43069.1 [P49238-1]
CCDS54571.1 [P49238-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC4304

NCBI Reference Sequences

More...
RefSeqi
NP_001164642.1, NM_001171171.1 [P49238-1]
NP_001164643.1, NM_001171172.1 [P49238-1]
NP_001164645.1, NM_001171174.1 [P49238-4]
NP_001328.1, NM_001337.3 [P49238-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.78913

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000358309; ENSP00000351059; ENSG00000168329 [P49238-4]
ENST00000399220; ENSP00000382166; ENSG00000168329 [P49238-1]
ENST00000541347; ENSP00000439140; ENSG00000168329 [P49238-1]
ENST00000542107; ENSP00000444928; ENSG00000168329 [P49238-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1524

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1524

UCSC genome browser

More...
UCSCi
uc003cjl.4 human [P49238-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20350 mRNA Translation: AAA91783.1
U28934 mRNA Translation: AAA87032.1
AY016370 Genomic DNA Translation: AAK08627.1
AK312373 mRNA Translation: BAG35291.1
DA413545 mRNA No translation available.
EF064744 Genomic DNA Translation: ABK41927.1
EU006531 Genomic DNA Translation: ABS29268.1
AC092053 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64576.1
BC028078 mRNA Translation: AAH28078.1
CCDSiCCDS43069.1 [P49238-1]
CCDS54571.1 [P49238-4]
PIRiJC4304
RefSeqiNP_001164642.1, NM_001171171.1 [P49238-1]
NP_001164643.1, NM_001171172.1 [P49238-1]
NP_001164645.1, NM_001171174.1 [P49238-4]
NP_001328.1, NM_001337.3 [P49238-1]
UniGeneiHs.78913

3D structure databases

ProteinModelPortaliP49238
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107904, 1 interactor
DIPiDIP-5879N
IntActiP49238, 4 interactors
STRINGi9606.ENSP00000351059

Chemistry databases

BindingDBiP49238
ChEMBLiCHEMBL4843
GuidetoPHARMACOLOGYi74

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiP49238
PhosphoSitePlusiP49238

Polymorphism and mutation databases

BioMutaiCX3CR1
DMDMi1351394

Proteomic databases

jPOSTiP49238
PaxDbiP49238
PeptideAtlasiP49238
PRIDEiP49238
ProteomicsDBi55973
55974 [P49238-2]
55975 [P49238-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1524
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358309; ENSP00000351059; ENSG00000168329 [P49238-4]
ENST00000399220; ENSP00000382166; ENSG00000168329 [P49238-1]
ENST00000541347; ENSP00000439140; ENSG00000168329 [P49238-1]
ENST00000542107; ENSP00000444928; ENSG00000168329 [P49238-1]
GeneIDi1524
KEGGihsa:1524
UCSCiuc003cjl.4 human [P49238-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1524
DisGeNETi1524
EuPathDBiHostDB:ENSG00000168329.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CX3CR1
HGNCiHGNC:2558 CX3CR1
HPAiCAB032478
HPA030311
HPA046587
HPA077743
MalaCardsiCX3CR1
MIMi601470 gene
609423 phenotype
613784 phenotype
neXtProtiNX_P49238
OpenTargetsiENSG00000168329
Orphaneti279 NON RARE IN EUROPE: Age-related macular degeneration
PharmGKBiPA27054

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGZ8 Eukaryota
ENOG41118PP LUCA
GeneTreeiENSGT00950000182621
HOGENOMiHOG000234122
HOVERGENiHBG106917
InParanoidiP49238
KOiK04192
OMAiPFWTHYV
OrthoDBi665362at2759
PhylomeDBiP49238
TreeFamiTF330966

Enzyme and pathway databases

ReactomeiR-HSA-380108 Chemokine receptors bind chemokines
R-HSA-418594 G alpha (i) signalling events
SIGNORiP49238

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CX3CR1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1524

Protein Ontology

More...
PROi
PR:P49238

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168329 Expressed in 208 organ(s), highest expression level in mononuclear cell
ExpressionAtlasiP49238 baseline and differential
GenevisibleiP49238 HS

Family and domain databases

CDDicd15186 7tmA_CX3CR1, 1 hit
InterProiView protein in InterPro
IPR005387 Chemokine_CX3CR1
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01562 FRACTALKINER
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCX3C1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P49238
Secondary accession number(s): A0N0N6, B2R5Z4, J3KP17
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: April 10, 2019
This is version 178 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again