UniProtKB - P49184 (DNSL1_HUMAN)

BLAST

>sp|P49184|DNSL1_HUMAN Deoxyribonuclease-1-like 1 OS=Homo sapiens OX=9606 GN=DNASE1L1 PE=1 SV=1
MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVD
SSGSAIPLLLRELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDED
DVFAREPFVAQFSLPSNVLPSLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILL
GDFNADCASLTKKRLDKLELRTEPGFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLL
HTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSVQPLSLTVLLLLSLLSPQLCP
AA

Align
Format
Add to basket Added to basket
History
Entry version 167 (07 Nov 2018)
Sequence version 1 (01 Feb 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Deoxyribonuclease-1-like 1

Gene

DNASE1L1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Active siteⁱ	97	By similarity		1
Active siteⁱ	148	By similarity		1

GO - Molecular functionⁱ

deoxyribonuclease activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
deoxyribonuclease I activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
DNA binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

DNA catabolic process
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
DNA catabolic process, endonucleolytic
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
DNA metabolic process
Source: ProtInc
Traceable author statementⁱ
- 9205125
neutrophil degranulation Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Endonuclease, Hydrolase, Nuclease

Molecular function

Endonuclease, Hydrolase, Nuclease

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation

Reactomeⁱ

R-HSA-6798695 Neutrophil degranulation

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Deoxyribonuclease-1-like 1 (EC:3.1.21.-) Alternative name(s): DNase X Deoxyribonuclease I-like 1 Short name: DNase I-like 1 Muscle-specific DNase I-like XIB
Gene namesⁱ	Name:DNASE1L1 Synonyms:DNAS1L1, DNL1L
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome X

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000013563.13
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:2957 DNASE1L1
MIMⁱ	300081 gene
neXtProtⁱ	NX_P49184

Keywords - Cellular componentⁱ

Endoplasmic reticulum

Pathology & Biotechⁱ

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000013563
PharmGKBⁱ	PA27428

Polymorphism and mutation databases

BioMutaⁱ	DNASE1L1
DMDMⁱ	1352319

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 18	Sequence analysisAdd BLAST		18
ChainⁱPRO_0000007284	19 – 302	Deoxyribonuclease-1-like 1Add BLAST		284

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Disulfide bondⁱ	187 ↔ 224	Essential for enzymatic activityBy similarity
Glycosylationⁱ	261	N-linked (GlcNAc...) asparagine1 Publication		1

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

EPDⁱ	P49184
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P49184
PaxDbⁱ	P49184
PeptideAtlas More...PeptideAtlasⁱ	P49184
PRIDEⁱ	P49184
ProteomicsDBⁱ	55967

PTM databases

iPTMnetⁱ	P49184
PhosphoSitePlusⁱ	P49184

Expressionⁱ

Tissue specificityⁱ

Highest levels in skeletal and cardiac muscles. Detectable in all other tissues tested except brain.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000013563 Expressed in 212 organ(s), highest expression level in quadriceps femoris
CleanExⁱ	HS_DNASE1L1
ExpressionAtlasⁱ	P49184 baseline and differential
Genevisibleⁱ	P49184 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA072635

HPAⁱ

HPA072635

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	108113, 6 interactors
STRINGⁱ	9606.ENSP00000014935

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P49184
SMRⁱ	P49184
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the DNase I family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	ENOG410IH3K Eukaryota ENOG410Z4MV LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000013146
HOGENOMⁱ	HOG000059570
HOVERGENⁱ	HBG051368
InParanoidⁱ	P49184
KEGG Orthology (KO) More...KOⁱ	K11995
OMAⁱ	LHGERCQ
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0I0B
PhylomeDBⁱ	P49184
TreeFamⁱ	TF329541

Family and domain databases

Gene3Dⁱ	3.60.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR018057 Deoxyribonuclease-1_AS IPR016202 DNase_I IPR033125 DNASE_I_2 IPR036691 Endo/exonu/phosph_ase_sf IPR005135 Endo/exonuclease/phosphatase
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF03372 Exo_endo_phos, 1 hit
PIRSFⁱ	PIRSF000988 DNase_I_euk, 1 hit
PRINTSⁱ	PR00130 DNASEI
SMARTⁱ	View protein in SMART SM00476 DNaseIc, 1 hit
SUPFAMⁱ	SSF56219 SSF56219, 1 hit
PROSITEⁱ	View protein in PROSITE PS00919 DNASE_I_1, 1 hit PS00918 DNASE_I_2, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 5 potential isoforms that are computationally mapped.Show all Align All

P49184-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MHYPTALLFL ILANGAQAFR ICAFNAQRLT LAKVAREQVM DTLVRILARC 
        60         70         80         90        100
DIMVLQEVVD SSGSAIPLLL RELNRFDGSG PYSTLSSPQL GRSTYMETYV 
       110        120        130        140        150
YFYRSHKTQV LSSYVYNDED DVFAREPFVA QFSLPSNVLP SLVLVPLHTT 
       160        170        180        190        200
PKAVEKELNA LYDVFLEVSQ HWQSKDVILL GDFNADCASL TKKRLDKLEL 
       210        220        230        240        250
RTEPGFHWVI ADGEDTTVRA STHCTYDRVV LHGERCRSLL HTAAAFDFPT 
       260        270        280        290        300
SFQLTEEEAL NISDHYPVEV ELKLSQAHSV QPLSLTVLLL LSLLSPQLCP 

AA

Length:302

Mass (Da):33,893

Last modified:February 1, 1996 - v1

Checksum:ⁱD10CE8B470173727

Computationally mapped potential isoform sequencesⁱ

There are 5 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A6QRJ0	A6QRJ0_HUMAN	Deoxyribonuclease-1-like 1 Deoxyribonuclease-1-like 1	DNASE1L1	208	Annotation score:
Q5HY40	Q5HY40_HUMAN	Deoxyribonuclease-1-like 1 Deoxyribonuclease-1-like 1	DNASE1L1	103	Annotation score:
E7ESG1	E7ESG1_HUMAN	Deoxyribonuclease-1-like 1 Deoxyribonuclease-1-like 1	DNASE1L1	62	Annotation score:
E7EUJ0	E7EUJ0_HUMAN	Deoxyribonuclease-1-like 1 Deoxyribonuclease-1-like 1	DNASE1L1	85	Annotation score:
A3KQT1	A3KQT1_HUMAN	Deoxyribonuclease-1-like 1 Deoxyribonuclease-1-like 1	DNASE1L1	26	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	73	L → I in AAB00496 (PubMed:8541839).Curated	1
Sequence conflictⁱ	78	G → D in AAB00496 (PubMed:8541839).Curated	1
Sequence conflictⁱ	205	G → S in AAB00496 (PubMed:8541839).Curated	1
Sequence conflictⁱ	227	D → A in AAB00495 (PubMed:8541839).Curated	1
Sequence conflictⁱ	227	D → A in AAA92647 (PubMed:8733135).Curated	1

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_048869	122	V → I. Corresponds to variant dbSNP:rs34952165Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X90392 mRNA Translation: CAA62037.1 L40817 Genomic DNA Translation: AAB00495.1 L40823 mRNA Translation: AAB00496.1 L44140 Genomic DNA Translation: AAA92647.1 U06846 mRNA Translation: AAB17022.1 BX936347 Genomic DNA No translation available. CH471172 Genomic DNA Translation: EAW72731.1 CH471172 Genomic DNA Translation: EAW72732.1 CH471172 Genomic DNA Translation: EAW72733.1 CH471172 Genomic DNA Translation: EAW72734.1 CH471172 Genomic DNA Translation: EAW72735.1 BC001561 mRNA Translation: AAH01561.1 BC028092 mRNA Translation: AAH28092.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS14747.1
PIRⁱ	JC4633
NCBI Reference Sequences More...RefSeqⁱ	NP_001009932.1, NM_001009932.2 NP_001009933.1, NM_001009933.2 NP_001009934.1, NM_001009934.2 NP_001290549.1, NM_001303620.1 NP_006721.1, NM_006730.3 XP_005277886.1, XM_005277829.4 XP_011529424.1, XM_011531122.2 XP_016884821.1, XM_017029332.1
UniGeneⁱ	Hs.401929 Hs.534404

Genome annotation databases

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P49184	Deoxyribonuclease-1-like 1		CHLAE		302	UniRef90_P49184
Deoxyribonuclease I-like 1		PANTR		361
Deoxyribonuclease-1-like 1 (Fragment)		HUMAN		26
Deoxyribonuclease		PLEMO		302
Deoxyribonuclease		RHIRO		302
+32

Protein	Similar proteins		Species	Score	Length	Source
P49184	Deoxyribonuclease-1-like 1		CHLAE		302	UniRef50_P49184
Deoxyribonuclease-1-like 1		CRIGR		304
Deoxyribonuclease I-like 1		PANTR		361
Deoxyribonuclease-1-like 1 (Fragment)		HUMAN		26
Deoxyribonuclease		MACMU		302
+49

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X90392 mRNA Translation: CAA62037.1 L40817 Genomic DNA Translation: AAB00495.1 L40823 mRNA Translation: AAB00496.1 L44140 Genomic DNA Translation: AAA92647.1 U06846 mRNA Translation: AAB17022.1 BX936347 Genomic DNA No translation available. CH471172 Genomic DNA Translation: EAW72731.1 CH471172 Genomic DNA Translation: EAW72732.1 CH471172 Genomic DNA Translation: EAW72733.1 CH471172 Genomic DNA Translation: EAW72734.1 CH471172 Genomic DNA Translation: EAW72735.1 BC001561 mRNA Translation: AAH01561.1 BC028092 mRNA Translation: AAH28092.1
CCDSⁱ	CCDS14747.1
PIRⁱ	JC4633
RefSeqⁱ	NP_001009932.1, NM_001009932.2 NP_001009933.1, NM_001009933.2 NP_001009934.1, NM_001009934.2 NP_001290549.1, NM_001303620.1 NP_006721.1, NM_006730.3 XP_005277886.1, XM_005277829.4 XP_011529424.1, XM_011531122.2 XP_016884821.1, XM_017029332.1
UniGeneⁱ	Hs.401929 Hs.534404

3D structure databases

ProteinModelPortalⁱ	P49184
SMRⁱ	P49184
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	108113, 6 interactors
STRINGⁱ	9606.ENSP00000014935

PTM databases

iPTMnetⁱ	P49184
PhosphoSitePlusⁱ	P49184

Polymorphism and mutation databases

BioMutaⁱ	DNASE1L1
DMDMⁱ	1352319

Proteomic databases

EPDⁱ	P49184
MaxQBⁱ	P49184
PaxDbⁱ	P49184
PeptideAtlasⁱ	P49184
PRIDEⁱ	P49184
ProteomicsDBⁱ	55967

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	1774
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000014935; ENSP00000014935; ENSG00000013563 ENST00000309585; ENSP00000309168; ENSG00000013563 ENST00000369807; ENSP00000358822; ENSG00000013563 ENST00000369808; ENSP00000358823; ENSG00000013563 ENST00000369809; ENSP00000358824; ENSG00000013563 ENST00000393638; ENSP00000377255; ENSG00000013563
GeneIDⁱ	1774
KEGGⁱ	hsa:1774
UCSCⁱ	uc033fbh.2 human

Organism-specific databases

CTDⁱ	1774
EuPathDBⁱ	HostDB:ENSG00000013563.13
GeneCardsⁱ	DNASE1L1
HGNCⁱ	HGNC:2957 DNASE1L1
HPAⁱ	HPA072635
MIMⁱ	300081 gene
neXtProtⁱ	NX_P49184
OpenTargetsⁱ	ENSG00000013563
PharmGKBⁱ	PA27428
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IH3K Eukaryota ENOG410Z4MV LUCA
GeneTreeⁱ	ENSGT00390000013146
HOGENOMⁱ	HOG000059570
HOVERGENⁱ	HBG051368
InParanoidⁱ	P49184
KOⁱ	K11995
OMAⁱ	LHGERCQ
OrthoDBⁱ	EOG091G0I0B
PhylomeDBⁱ	P49184
TreeFamⁱ	TF329541

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation

Reactomeⁱ

R-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

GeneWikiⁱ	DNASE1L1
GenomeRNAiⁱ	1774
Protein Ontology More...PROⁱ	PR:P49184
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000013563 Expressed in 212 organ(s), highest expression level in quadriceps femoris
CleanExⁱ	HS_DNASE1L1
ExpressionAtlasⁱ	P49184 baseline and differential
Genevisibleⁱ	P49184 HS

Family and domain databases

Gene3Dⁱ	3.60.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR018057 Deoxyribonuclease-1_AS IPR016202 DNase_I IPR033125 DNASE_I_2 IPR036691 Endo/exonu/phosph_ase_sf IPR005135 Endo/exonuclease/phosphatase
Pfamⁱ	View protein in Pfam PF03372 Exo_endo_phos, 1 hit
PIRSFⁱ	PIRSF000988 DNase_I_euk, 1 hit
PRINTSⁱ	PR00130 DNASEI
SMARTⁱ	View protein in SMART SM00476 DNaseIc, 1 hit
SUPFAMⁱ	SSF56219 SSF56219, 1 hit
PROSITEⁱ	View protein in PROSITE PS00919 DNASE_I_1, 1 hit PS00918 DNASE_I_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	DNSL1_HUMAN
Accessionⁱ	P49184Primary (citable) accession number: P49184 Secondary accession number(s): D3DWW7, Q5HY41
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1996
	Last sequence update:	February 1, 1996
	Last modified:	November 7, 2018
	This is version 167 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome X
Human chromosome X: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P49184 (DNSL1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Deoxyribonuclease-1-like 1

DNASE1L1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endoplasmic reticulum

Endoplasmic reticulum

Extracellular region or secreted

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ