Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heat shock 70 kDa protein 4L

Gene

Hspa4l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChaperone
Biological processStress response
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-3371453 Regulation of HSF1-mediated heat shock response

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock 70 kDa protein 4L
Alternative name(s):
Heat shock 70-related protein APG-1
Osmotic stress protein 94
Gene namesi
Name:Hspa4l
Synonyms:Apg1, Hsp4l, Osp94
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:107422 Hspa4l

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000782811 – 838Heat shock 70 kDa protein 4LAdd BLAST838

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei74PhosphoserineCombined sources1
Modified residuei545PhosphothreonineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei761PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP48722
MaxQBiP48722
PaxDbiP48722
PeptideAtlasiP48722
PRIDEiP48722

2D gel databases

REPRODUCTION-2DPAGEiIPI00317710
P48722

PTM databases

iPTMnetiP48722
PhosphoSitePlusiP48722
SwissPalmiP48722

Expressioni

Tissue specificityi

Highly expressed in testis. Also expressed in renal medulla of water-restricted animals.1 Publication

Inductioni

By hyperosmolar salt stress and heat shock.1 Publication

Gene expression databases

BgeeiENSMUSG00000025757 Expressed in 285 organ(s), highest expression level in testis
CleanExiMM_HSPA4L
ExpressionAtlasiP48722 baseline and differential
GenevisibleiP48722 MM

Interactioni

Subunit structurei

Homodimer.By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi201985, 2 interactors
IntActiP48722, 3 interactors
MINTiP48722
STRINGi10090.ENSMUSP00000076336

Structurei

3D structure databases

ProteinModelPortaliP48722
SMRiP48722
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the heat shock protein 70 family.Curated

Phylogenomic databases

eggNOGiKOG0103 Eukaryota
COG0443 LUCA
GeneTreeiENSGT00390000016919
HOVERGENiHBG047955
InParanoidiP48722
KOiK09485
OrthoDBiEOG091G04Y6
PhylomeDBiP48722
TreeFamiTF105043

Family and domain databases

Gene3Di1.20.1270.10, 1 hit
2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029048 HSP70_C_sf
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
PANTHERiPTHR19375 PTHR19375, 1 hit
PfamiView protein in Pfam
PF00012 HSP70, 1 hit
PRINTSiPR00301 HEATSHOCK70
SUPFAMiSSF100920 SSF100920, 1 hit
SSF100934 SSF100934, 2 hits
PROSITEiView protein in PROSITE
PS00329 HSP70_2, 1 hit
PS01036 HSP70_3, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P48722-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVVGIDLGF LNCYIAVARS GGIETIANEY SDRCTPACIS LGSRTRAIGN
60 70 80 90 100
AAKSQIVTNV RNTIHGFKKL HGRSFDDPIV QTERIRLPYE LQKMPNGSTG
110 120 130 140 150
VKVRYLEEER PFAIEQVTGM LLAKLKETSE NALKKPVADC VISIPSFFTD
160 170 180 190 200
AERRSVMAAA QVAGLNCLRL MNETTAVALA YGIYKQDLPS LDEKPRNVVF
210 220 230 240 250
IDMGHSAYQV SVCAFNKGKL KVLATTFDPY LGGRNFDEAL VDYFCDEFKT
260 270 280 290 300
KYKINVKENS RALLRLYQEC EKLKKLMSAN ASDLPLNIEC FMNDLDVSSK
310 320 330 340 350
MNRAQFEQLC ASLLARVEPP LKSVMDQANL QREDINSIEI VGGATRIPAV
360 370 380 390 400
KEQVTRFFLK DISTTLNADE AVARGCALQC AILSPAFKVR EFSITDLVPY
410 420 430 440 450
SVTLRWKTSF EEGTGECEVF SKNHPAPFSK VITFHKKEPF ELEAFYTNLH
460 470 480 490 500
EVPYPDPRIG NFTIQNVFPQ SDGDSSKVKV KVRINIHGIF SVASASVIEK
510 520 530 540 550
QNLEGDHNDA AMETEAPKSE GKEDVDKMQV DQEEGGHQKC HAEHTPEEEI
560 570 580 590 600
DHTGAKAKAP PSDKQDRINQ TIKKGKIKSI DLPIQSSLYR QLTQDLLNSY
610 620 630 640 650
IENEGKMIMQ DKLEKERNDA KNAVEEYVYD FRDKLGTVYE KFITPEDMNK
660 670 680 690 700
LSAMLEDTEN WLYEEGEDQP KQVYVDRLQE LKKYGQPIQM KYVEHEERPK
710 720 730 740 750
ALNDLGKKIQ LVLKVIEAHR NKDERYDHLD PAEMERVEKY ISDSMNWLNS
760 770 780 790 800
KMNAQNKLSL TQDPVVKVSE IVTKSKELDN FCNPIVYKPK PKVEAPEDKA
810 820 830
KTGSEHNGPM DGQSGSETSP DPPKGSSQHT DSGEMEVD
Length:838
Mass (Da):94,382
Last modified:May 23, 2003 - v2
Checksum:iB2C5847DA7EAF6B7
GO
Isoform 2 (identifier: P48722-2) [UniParc]FASTAAdd to basket
Also known as: Apg-1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTP → MGGPPRHGVLDREER

Show »
Length:817
Mass (Da):92,252
Checksum:i38B0704DFEDE5DD4
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E0CY23E0CY23_MOUSE
Heat shock 70 kDa protein 4L
Hspa4l
571Annotation score:
A0A0N4SW76A0A0N4SW76_MOUSE
Heat shock 70 kDa protein 4L
Hspa4l
125Annotation score:
A0A0N4SVU2A0A0N4SVU2_MOUSE
Heat shock 70 kDa protein 4L
Hspa4l
158Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti175 – 176TA → HS in BAA08446 (PubMed:9006898).Curated2
Sequence conflicti175 – 176TA → HS in BAA19468 (Ref. 3) Curated2
Sequence conflicti221K → E in BAA08446 (PubMed:9006898).Curated1
Sequence conflicti221K → E in BAA19468 (Ref. 3) Curated1
Sequence conflicti279A → P in BAA08446 (PubMed:9006898).Curated1
Sequence conflicti279A → P in BAA19468 (Ref. 3) Curated1
Sequence conflicti308Q → R in BAA08446 (PubMed:9006898).Curated1
Sequence conflicti308Q → R in BAA19468 (Ref. 3) Curated1
Sequence conflicti483R → S in BAE37350 (PubMed:16141072).Curated1
Sequence conflicti571T → A in BAE37350 (PubMed:16141072).Curated1
Sequence conflicti776K → M in AAC52610 (PubMed:8647834).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0075001 – 36MSVVG…DRCTP → MGGPPRHGVLDREER in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U23921 mRNA Translation: AAC52610.1
D49482 mRNA Translation: BAA08446.1
AB001926 mRNA Translation: BAA19468.1
AK033950 mRNA Translation: BAC28524.1
AK050997 mRNA Translation: BAC34491.1
AK144225 mRNA Translation: BAE25783.1
AK163459 mRNA Translation: BAE37350.1
BC012712 mRNA Translation: AAH12712.1
BC057002 mRNA Translation: AAH57002.1
BC110662 mRNA Translation: AAI10663.1
CCDSiCCDS17327.1 [P48722-1]
RefSeqiNP_035150.3, NM_011020.3 [P48722-1]
XP_006500829.2, XM_006500766.3 [P48722-1]
XP_006500830.1, XM_006500767.3 [P48722-1]
UniGeneiMm.39330

Genome annotation databases

EnsembliENSMUST00000108086; ENSMUSP00000103721; ENSMUSG00000025757 [P48722-2]
ENSMUST00000204702; ENSMUSP00000145468; ENSMUSG00000025757 [P48722-1]
ENSMUST00000229561; ENSMUSP00000154874; ENSMUSG00000115951 [P48722-2]
ENSMUST00000230348; ENSMUSP00000155315; ENSMUSG00000115951 [P48722-1]
GeneIDi18415
KEGGimmu:18415
UCSCiuc008pbk.1 mouse [P48722-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U23921 mRNA Translation: AAC52610.1
D49482 mRNA Translation: BAA08446.1
AB001926 mRNA Translation: BAA19468.1
AK033950 mRNA Translation: BAC28524.1
AK050997 mRNA Translation: BAC34491.1
AK144225 mRNA Translation: BAE25783.1
AK163459 mRNA Translation: BAE37350.1
BC012712 mRNA Translation: AAH12712.1
BC057002 mRNA Translation: AAH57002.1
BC110662 mRNA Translation: AAI10663.1
CCDSiCCDS17327.1 [P48722-1]
RefSeqiNP_035150.3, NM_011020.3 [P48722-1]
XP_006500829.2, XM_006500766.3 [P48722-1]
XP_006500830.1, XM_006500767.3 [P48722-1]
UniGeneiMm.39330

3D structure databases

ProteinModelPortaliP48722
SMRiP48722
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201985, 2 interactors
IntActiP48722, 3 interactors
MINTiP48722
STRINGi10090.ENSMUSP00000076336

PTM databases

iPTMnetiP48722
PhosphoSitePlusiP48722
SwissPalmiP48722

2D gel databases

REPRODUCTION-2DPAGEiIPI00317710
P48722

Proteomic databases

EPDiP48722
MaxQBiP48722
PaxDbiP48722
PeptideAtlasiP48722
PRIDEiP48722

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000108086; ENSMUSP00000103721; ENSMUSG00000025757 [P48722-2]
ENSMUST00000204702; ENSMUSP00000145468; ENSMUSG00000025757 [P48722-1]
ENSMUST00000229561; ENSMUSP00000154874; ENSMUSG00000115951 [P48722-2]
ENSMUST00000230348; ENSMUSP00000155315; ENSMUSG00000115951 [P48722-1]
GeneIDi18415
KEGGimmu:18415
UCSCiuc008pbk.1 mouse [P48722-1]

Organism-specific databases

CTDi22824
MGIiMGI:107422 Hspa4l

Phylogenomic databases

eggNOGiKOG0103 Eukaryota
COG0443 LUCA
GeneTreeiENSGT00390000016919
HOVERGENiHBG047955
InParanoidiP48722
KOiK09485
OrthoDBiEOG091G04Y6
PhylomeDBiP48722
TreeFamiTF105043

Enzyme and pathway databases

ReactomeiR-MMU-3371453 Regulation of HSF1-mediated heat shock response

Miscellaneous databases

ChiTaRSiHspa4l mouse
PROiPR:P48722
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000025757 Expressed in 285 organ(s), highest expression level in testis
CleanExiMM_HSPA4L
ExpressionAtlasiP48722 baseline and differential
GenevisibleiP48722 MM

Family and domain databases

Gene3Di1.20.1270.10, 1 hit
2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029048 HSP70_C_sf
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
PANTHERiPTHR19375 PTHR19375, 1 hit
PfamiView protein in Pfam
PF00012 HSP70, 1 hit
PRINTSiPR00301 HEATSHOCK70
SUPFAMiSSF100920 SSF100920, 1 hit
SSF100934 SSF100934, 2 hits
PROSITEiView protein in PROSITE
PS00329 HSP70_2, 1 hit
PS01036 HSP70_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHS74L_MOUSE
AccessioniPrimary (citable) accession number: P48722
Secondary accession number(s): P97854
, Q3TQN2, Q3UNG4, Q8BQD0, Q8CC45, Q91X29
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: May 23, 2003
Last modified: November 7, 2018
This is version 148 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again