Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (11 Dec 2019)
Sequence version 2 (24 May 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Arginine kinase

Gene

Argk

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei185ATPPROSITE-ProRule annotation1
Binding sitei225SubstrateBy similarity1
Binding sitei229ATPPROSITE-ProRule annotation1
Binding sitei271SubstrateBy similarity1
Binding sitei314SubstrateBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi122 – 126ATPPROSITE-ProRule annotation5
Nucleotide bindingi280 – 284ATPPROSITE-ProRule annotation5
Nucleotide bindingi309 – 314ATPPROSITE-ProRule annotation6

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-71288 Creatine metabolism

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Arginine kinase (EC:2.7.3.3)
Short name:
AK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Argk
ORF Names:CG32031
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0000116 Argk

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002119921 – 356Arginine kinaseAdd BLAST356

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P48610

PRoteomics IDEntifications database

More...
PRIDEi
P48610

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0000116 Expressed in 41 organ(s), highest expression level in multi-cellular organism

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P48610 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P48610 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
64445, 60 interactors

Protein interaction database and analysis system

More...
IntActi
P48610, 16 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0076270

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P48610

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 91Phosphagen kinase N-terminalPROSITE-ProRule annotationAdd BLAST86
Domaini119 – 356Phosphagen kinase C-terminalPROSITE-ProRule annotationAdd BLAST238

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni64 – 68Substrate bindingBy similarity5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ATP:guanido phosphotransferase family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3581 Eukaryota
COG3869 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182772

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P48610

KEGG Orthology (KO)

More...
KOi
K00934

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P48610

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.135.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000749 ATP-guanido_PTrfase
IPR022415 ATP-guanido_PTrfase_AS
IPR022414 ATP-guanido_PTrfase_cat
IPR022413 ATP-guanido_PTrfase_N
IPR036802 ATP-guanido_PTrfase_N_sf
IPR014746 Gln_synth/guanido_kin_cat_dom

The PANTHER Classification System

More...
PANTHERi
PTHR11547 PTHR11547, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00217 ATP-gua_Ptrans, 1 hit
PF02807 ATP-gua_PtransN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48034 SSF48034, 1 hit
SSF55931 SSF55931, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00112 PHOSPHAGEN_KINASE, 1 hit
PS51510 PHOSPHAGEN_KINASE_C, 1 hit
PS51509 PHOSPHAGEN_KINASE_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform D (identifier: P48610-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVDAAVLAKL EEGYAKLAAS DSKSLLKKYL TKEVFDNLKN KVTPTFKSTL
60 70 80 90 100
LDVIQSGLEN HDSGVGIYAP DAEAYTVFAD LFDPIIEDYH GGFKKTDKHP
110 120 130 140 150
ASNFGDVSTF GNVDPTNEYV ISTRVRCGRS MQGYPFNPCL TEAQYKEMES
160 170 180 190 200
KVSSTLSGLE GELKGKFYPL TGMEKAVQQQ LIDDHFLFKE GDRFLQAANA
210 220 230 240 250
CRFWPSGRGI YHNDAKTFLV WCNEEDHLRI ISMQQGGDLG QIYKRLVTAV
260 270 280 290 300
NEIEKRVPFS HDDRLGFLTF CPTNLGTTIR ASVHIKVPKL ASNKAKLEEV
310 320 330 340 350
AAKYNLQVRG TRGEHTEAEG GVYDISNKRR MGLTEFEAVK EMYDGITELI

KLEKSL
Length:356
Mass (Da):39,866
Last modified:May 24, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9AD0E80D2CE4F446
GO
Isoform A (identifier: P48610-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFALWYLTFA...QLGERKQDTM

Show »
Length:562
Mass (Da):61,264
Checksum:iD05E15973650E0B7
GO
Isoform B (identifier: P48610-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPIPLPKSLT...QLGERKQDTM

Show »
Length:432
Mass (Da):47,889
Checksum:iD3CC748B41704E59
GO
Isoform C (identifier: P48610-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGLCASKDKKEKVIEGEVANGEPNGTATAAGAGGDGKQDTM

Show »
Length:396
Mass (Da):43,754
Checksum:iAD60FC4C81C1E9C4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8JNP2A8JNP2_DROME
Arginine kinase, isoform E
Argk AK, AK-1, ArgK, argK, argk
375Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8JNP1A8JNP1_DROME
Arginine kinase, isoform G
Argk AK, AK-1, ArgK, argK, argk
356Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1 – 90Missing in AAA68173 (Ref. 1) CuratedAdd BLAST90
Sequence conflicti42 – 51VTPTFKSTLL → GHAHLQVDPA in AAA68172 (Ref. 1) Curated10
Sequence conflicti64 – 66GVG → ASA in AAA68172 (Ref. 1) Curated3
Sequence conflicti85I → F in AAA68172 (Ref. 1) Curated1
Sequence conflicti280R → L in AAA68172 (Ref. 1) Curated1
Sequence conflicti291A → P in AAA68172 (Ref. 1) Curated1
Sequence conflicti309 – 313RGTRG → ANPR in AAA68172 (Ref. 1) Curated5
Sequence conflicti322V → S in AAA68172 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0138071M → MFALWYLTFAVDEIRKRLAW LFSSNKPAAPALDNKPANPA PAKESAPAPAPAPTPKPAVV PPAPKPDPPKPAPAVAKPTP VPVPATAPAPPKEEPAPKPK PEPVPSPVVAPPKPTPPPAK PSSPPKQADKMPIPLPKSLT EANTNGQNGNAANGGNVDEL VFGGQQAEKVLPAAKEASND FIKGETNAFIQSIKEAQQLG ERKQDTM in isoform A. 1 Publication1
Alternative sequenceiVSP_0138081M → MPIPLPKSLTEANTNGQNGN AANGGNVDELVFGGQQAEKV LPAAKEASNDFIKGETNAFI QSIKEAQQLGERKQDTM in isoform B. Curated1
Alternative sequenceiVSP_0138091M → MGLCASKDKKEKVIEGEVAN GEPNGTATAAGAGGDGKQDT M in isoform C. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U26939 Genomic DNA Translation: AAA68172.1
U26940 mRNA Translation: AAA68173.1
AE014296 Genomic DNA Translation: AAF50325.2
AE014296 Genomic DNA Translation: AAF50326.2
AE014296 Genomic DNA Translation: AAN11982.1
AE014296 Genomic DNA Translation: AAN11983.1
AY069099 mRNA Translation: AAL39244.1

NCBI Reference Sequences

More...
RefSeqi
NP_001097556.2, NM_001104086.2 [P48610-1]
NP_001286989.1, NM_001300060.1 [P48610-1]
NP_523988.2, NM_079264.3 [P48610-1]
NP_729446.1, NM_168311.3 [P48610-2]
NP_729447.1, NM_168312.3 [P48610-3]
NP_729448.1, NM_168313.4 [P48610-4]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0076543; FBpp0076270; FBgn0000116 [P48610-2]
FBtr0076544; FBpp0076271; FBgn0000116 [P48610-3]
FBtr0076545; FBpp0076272; FBgn0000116 [P48610-1]
FBtr0076546; FBpp0076273; FBgn0000116 [P48610-4]
FBtr0331550; FBpp0303940; FBgn0000116 [P48610-1]
FBtr0345030; FBpp0311280; FBgn0000116 [P48610-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
39041

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG32031

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26939 Genomic DNA Translation: AAA68172.1
U26940 mRNA Translation: AAA68173.1
AE014296 Genomic DNA Translation: AAF50325.2
AE014296 Genomic DNA Translation: AAF50326.2
AE014296 Genomic DNA Translation: AAN11982.1
AE014296 Genomic DNA Translation: AAN11983.1
AY069099 mRNA Translation: AAL39244.1
RefSeqiNP_001097556.2, NM_001104086.2 [P48610-1]
NP_001286989.1, NM_001300060.1 [P48610-1]
NP_523988.2, NM_079264.3 [P48610-1]
NP_729446.1, NM_168311.3 [P48610-2]
NP_729447.1, NM_168312.3 [P48610-3]
NP_729448.1, NM_168313.4 [P48610-4]

3D structure databases

SMRiP48610
ModBaseiSearch...

Protein-protein interaction databases

BioGridi64445, 60 interactors
IntActiP48610, 16 interactors
STRINGi7227.FBpp0076270

Proteomic databases

PaxDbiP48610
PRIDEiP48610

Genome annotation databases

EnsemblMetazoaiFBtr0076543; FBpp0076270; FBgn0000116 [P48610-2]
FBtr0076544; FBpp0076271; FBgn0000116 [P48610-3]
FBtr0076545; FBpp0076272; FBgn0000116 [P48610-1]
FBtr0076546; FBpp0076273; FBgn0000116 [P48610-4]
FBtr0331550; FBpp0303940; FBgn0000116 [P48610-1]
FBtr0345030; FBpp0311280; FBgn0000116 [P48610-1]
GeneIDi39041
KEGGidme:Dmel_CG32031

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
39041
FlyBaseiFBgn0000116 Argk

Phylogenomic databases

eggNOGiKOG3581 Eukaryota
COG3869 LUCA
GeneTreeiENSGT00950000182772
InParanoidiP48610
KOiK00934
PhylomeDBiP48610

Enzyme and pathway databases

ReactomeiR-DME-71288 Creatine metabolism

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Argk fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
39041

Protein Ontology

More...
PROi
PR:P48610

Gene expression databases

BgeeiFBgn0000116 Expressed in 41 organ(s), highest expression level in multi-cellular organism
ExpressionAtlasiP48610 baseline and differential
GenevisibleiP48610 DM

Family and domain databases

Gene3Di1.10.135.10, 1 hit
InterProiView protein in InterPro
IPR000749 ATP-guanido_PTrfase
IPR022415 ATP-guanido_PTrfase_AS
IPR022414 ATP-guanido_PTrfase_cat
IPR022413 ATP-guanido_PTrfase_N
IPR036802 ATP-guanido_PTrfase_N_sf
IPR014746 Gln_synth/guanido_kin_cat_dom
PANTHERiPTHR11547 PTHR11547, 1 hit
PfamiView protein in Pfam
PF00217 ATP-gua_Ptrans, 1 hit
PF02807 ATP-gua_PtransN, 1 hit
SUPFAMiSSF48034 SSF48034, 1 hit
SSF55931 SSF55931, 1 hit
PROSITEiView protein in PROSITE
PS00112 PHOSPHAGEN_KINASE, 1 hit
PS51510 PHOSPHAGEN_KINASE_C, 1 hit
PS51509 PHOSPHAGEN_KINASE_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKARG_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P48610
Secondary accession number(s): Q8IQB9
, Q8IQC0, Q8T0S2, Q9VST5, Q9VST6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: May 24, 2005
Last modified: December 11, 2019
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again