Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P48059 (LIMS1_HUMAN)

Entry version 192 (13 Feb 2019)
Sequence version 4 (23 Jan 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

LIM and senescent cell antigen-like-containing domain protein 1

Gene

LIMS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein kinase binding Source: UniProtKB
  • zinc ion binding Source: UniProtKB
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-446353 Cell-extracellular matrix interactions
R-HSA-446388 Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM and senescent cell antigen-like-containing domain protein 1
Alternative name(s):
Particularly interesting new Cys-His protein 1
Short name:
PINCH-1
Renal carcinoma antigen NY-REN-48
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LIMS1
Synonyms:PINCH, PINCH1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000169756.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:6616 LIMS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602567 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P48059

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi42F → A: Loss of interaction with ILK and loss of localization to focal adhesion. 2 Publications1
Mutagenesisi56R → A: Alters interaction with ILK. 1 Publication1
Mutagenesisi61H → D: Alters interaction with ILK. 1 Publication1
Mutagenesisi62D → A: Alters interaction with ILK. 1 Publication1
Mutagenesisi66L → D: Alters interaction with ILK. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		3987

Open Targets

More...OpenTargetsi		ENSG00000169756

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30389

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		LIMS1

Domain mapping of disease mutations (DMDM)

More...DMDMi		18266876

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758882 – 325LIM and senescent cell antigen-like-containing domain protein 1Add BLAST324

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanine1 Publication1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P48059

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P48059

MaxQB - The MaxQuant DataBase

More...MaxQBi		P48059

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P48059

PeptideAtlas

More...PeptideAtlasi		P48059

PRoteomics IDEntifications database

More...PRIDEi		P48059

ProteomicsDB human proteome resource

More...ProteomicsDBi		55846
55847 [P48059-2]
55848 [P48059-3]
55849 [P48059-4]
55850 [P48059-5]

2D gel databases

USC-OGP 2-DE database

More...OGPi		P48059

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P48059

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P48059

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in most tissues except in the brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000169756 Expressed in 207 organ(s), highest expression level in endometrium

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P48059 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P48059 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA058455
HPA061230

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via LIM zinc-binding 5) with TGFB1I1 (By similarity). Interacts with integrin-linked protein kinase 1 (ILK) via the first LIM domain, and in competition with LIMS2. Part of the heterotrimeric IPP complex composed of integrin-linked kinase (ILK), LIMS1 or LIMS2, and PARVA. Interacts with SH3/SH2 adapter NCK2, thereby linking the complex to cell surface receptors.By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		110175, 37 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P48059

Database of interacting proteins

More...DIPi		DIP-40671N

Protein interaction database and analysis system

More...IntActi		P48059, 53 interactors

Molecular INTeraction database

More...MINTi		P48059

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000446121

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1325
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1G47NMR-A1-70[»]
1NYPNMR-A188-251[»]
1U5SNMR-B188-251[»]
2CORNMR-A125-190[»]
2D8XNMR-A71-127[»]
2KBXNMR-B1-70[»]
3F6QX-ray1.60B6-68[»]
4HI8X-ray1.20B6-68[»]
4HI9X-ray1.20B6-68[»]
6MIFNMR-A249-325[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P48059

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P48059

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P48059

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini10 – 62LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST53
Domaini71 – 121LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST51
Domaini135 – 184LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST50
Domaini193 – 243LIM zinc-binding 4PROSITE-ProRule annotationAdd BLAST51
Domaini252 – 303LIM zinc-binding 5PROSITE-ProRule annotationAdd BLAST52

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2272 Eukaryota
ENOG410XP46 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153518

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000253950

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG000053

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P48059

Identification of Orthologs from Complete Genome Data

More...OMAi		PFPDGIY

Database of Orthologous Groups

More...OrthoDBi		1593918at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P48059

TreeFam database of animal gene trees

More...TreeFami		TF314113

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR017351 PINCH
IPR001781 Znf_LIM

The PANTHER Classification System

More...PANTHERi		PTHR24210 PTHR24210, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00412 LIM, 5 hits

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF038003 PINCH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00132 LIM, 5 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00478 LIM_DOMAIN_1, 4 hits
PS50023 LIM_DOMAIN_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P48059-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANALASATC ERCKGGFAPA EKIVNSNGEL YHEQCFVCAQ CFQQFPEGLF 
        60         70         80         90        100
YEFEGRKYCE HDFQMLFAPC CHQCGEFIIG RVIKAMNNSW HPECFRCDLC 
       110        120        130        140        150
QEVLADIGFV KNAGRHLCRP CHNREKARGL GKYICQKCHA IIDEQPLIFK 
       160        170        180        190        200
NDPYHPDHFN CANCGKELTA DARELKGELY CLPCHDKMGV PICGACRRPI 
       210        220        230        240        250
EGRVVNAMGK QWHVEHFVCA KCEKPFLGHR HYERKGLAYC ETHYNQLFGD 
       260        270        280        290        300
VCFHCNRVIE GDVVSALNKA WCVNCFACST CNTKLTLKNK FVEFDMKPVC 
       310        320 
KKCYEKFPLE LKKRLKKLAE TLGRK
Length:325
Mass (Da):37,251
Last modified:January 23, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE665FEB11D849CAE
GO
Isoform 2 (identifier: P48059-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLGVAAGMTHSNM

Note: No experimental confirmation available.
Show »
Length:337
Mass (Da):38,422
Checksum:i8577792E1A56418B
GO
Isoform 3 (identifier: P48059-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAKFNM

Show »
Length:387
Mass (Da):44,390
Checksum:i3AB2EDB2203CEBFF
GO
Isoform 4 (identifier: P48059-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTCNM

Show »
Length:329
Mass (Da):37,701
Checksum:iA69518B2E12F39A5
GO
Isoform 5 (identifier: P48059-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNM

Show »
Length:362
Mass (Da):41,571
Checksum:iB2123BE2DDC4736C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WC86F8WC86_HUMAN
LIM and senescent cell antigen-like...
LIMS1
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WE10F8WE10_HUMAN
LIM and senescent cell antigen-like...
LIMS1
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JF46C9JF46_HUMAN
LIM and senescent cell antigen-like...
LIMS1
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WB59F8WB59_HUMAN
LIM and senescent cell antigen-like...
LIMS1
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0M3HER1A0A0M3HER1_HUMAN
LIM and senescent cell antigen-like...
LIMS1
209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti78I → T in AAH05341 (PubMed:15489334).Curated1
Sequence conflicti262D → G in AAH05341 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0426721M → MLGVAAGMTHSNM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0432101M → MAFSGRARPCIIPENEEIPR AALNTVHEANGTEDERAVSK LQRRHSDVKVYKEFCDFYAK FNM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0432111M → MTCNM in isoform 4. Curated1
Alternative sequenceiVSP_0432121M → MTALQLKELSHSGLYRRRRD RPDSLRVNGLPEEELSNM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U09284 mRNA Translation: AAA20086.2
AK296992 mRNA Translation: BAH12469.1
AK302411 mRNA Translation: BAH13699.1
AK304260 mRNA Translation: BAH14143.1
AK314217 mRNA Translation: BAG36891.1
AC010095 Genomic DNA Translation: AAY14983.1
AC012487 Genomic DNA No translation available.
BC005341 mRNA Translation: AAH05341.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2078.1 [P48059-1]
CCDS54382.1 [P48059-2]
CCDS54383.1 [P48059-4]
CCDS54384.1 [P48059-5]
CCDS54385.1 [P48059-3]

Protein sequence database of the Protein Information Resource

More...PIRi		JC2324

NCBI Reference Sequences

More...RefSeqi		NP_001180411.1, NM_001193482.1 [P48059-4]
NP_001180412.1, NM_001193483.2 [P48059-2]
NP_001180413.1, NM_001193484.1 [P48059-5]
NP_001180414.1, NM_001193485.2 [P48059-3]
NP_001180417.1, NM_001193488.1 [P48059-1]
NP_004978.2, NM_004987.5 [P48059-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.597715
Hs.613268

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000332345; ENSP00000331775; ENSG00000169756 [P48059-1]
ENST00000338045; ENSP00000337598; ENSG00000169756 [P48059-3]
ENST00000393310; ENSP00000376987; ENSG00000169756 [P48059-1]
ENST00000409441; ENSP00000387264; ENSG00000169756 [P48059-5]
ENST00000410093; ENSP00000386926; ENSG00000169756 [P48059-4]
ENST00000544547; ENSP00000437912; ENSG00000169756 [P48059-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3987

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3987

UCSC genome browser

More...UCSCi		uc002teg.4 human [P48059-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U09284 mRNA Translation: AAA20086.2
AK296992 mRNA Translation: BAH12469.1
AK302411 mRNA Translation: BAH13699.1
AK304260 mRNA Translation: BAH14143.1
AK314217 mRNA Translation: BAG36891.1
AC010095 Genomic DNA Translation: AAY14983.1
AC012487 Genomic DNA No translation available.
BC005341 mRNA Translation: AAH05341.1
CCDSiCCDS2078.1 [P48059-1]
CCDS54382.1 [P48059-2]
CCDS54383.1 [P48059-4]
CCDS54384.1 [P48059-5]
CCDS54385.1 [P48059-3]
PIRiJC2324
RefSeqiNP_001180411.1, NM_001193482.1 [P48059-4]
NP_001180412.1, NM_001193483.2 [P48059-2]
NP_001180413.1, NM_001193484.1 [P48059-5]
NP_001180414.1, NM_001193485.2 [P48059-3]
NP_001180417.1, NM_001193488.1 [P48059-1]
NP_004978.2, NM_004987.5 [P48059-1]
UniGeneiHs.597715
Hs.613268

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1G47NMR-A1-70[»]
1NYPNMR-A188-251[»]
1U5SNMR-B188-251[»]
2CORNMR-A125-190[»]
2D8XNMR-A71-127[»]
2KBXNMR-B1-70[»]
3F6QX-ray1.60B6-68[»]
4HI8X-ray1.20B6-68[»]
4HI9X-ray1.20B6-68[»]
6MIFNMR-A249-325[»]
ProteinModelPortaliP48059
SMRiP48059
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110175, 37 interactors
CORUMiP48059
DIPiDIP-40671N
IntActiP48059, 53 interactors
MINTiP48059
STRINGi9606.ENSP00000446121

PTM databases

iPTMnetiP48059
PhosphoSitePlusiP48059

Polymorphism and mutation databases

BioMutaiLIMS1
DMDMi18266876

2D gel databases

OGPiP48059

Proteomic databases

EPDiP48059
jPOSTiP48059
MaxQBiP48059
PaxDbiP48059
PeptideAtlasiP48059
PRIDEiP48059
ProteomicsDBi55846
55847 [P48059-2]
55848 [P48059-3]
55849 [P48059-4]
55850 [P48059-5]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		3987
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332345; ENSP00000331775; ENSG00000169756 [P48059-1]
ENST00000338045; ENSP00000337598; ENSG00000169756 [P48059-3]
ENST00000393310; ENSP00000376987; ENSG00000169756 [P48059-1]
ENST00000409441; ENSP00000387264; ENSG00000169756 [P48059-5]
ENST00000410093; ENSP00000386926; ENSG00000169756 [P48059-4]
ENST00000544547; ENSP00000437912; ENSG00000169756 [P48059-2]
GeneIDi3987
KEGGihsa:3987
UCSCiuc002teg.4 human [P48059-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3987
DisGeNETi3987
EuPathDBiHostDB:ENSG00000169756.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		LIMS1
HGNCiHGNC:6616 LIMS1
HPAiHPA058455
HPA061230
MIMi602567 gene
neXtProtiNX_P48059
OpenTargetsiENSG00000169756
PharmGKBiPA30389

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2272 Eukaryota
ENOG410XP46 LUCA
GeneTreeiENSGT00940000153518
HOGENOMiHOG000253950
HOVERGENiHBG000053
InParanoidiP48059
OMAiPFPDGIY
OrthoDBi1593918at2759
PhylomeDBiP48059
TreeFamiTF314113

Enzyme and pathway databases

ReactomeiR-HSA-446353 Cell-extracellular matrix interactions
R-HSA-446388 Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		LIMS1 human
EvolutionaryTraceiP48059

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		LIMS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3987

Protein Ontology

More...PROi		PR:P48059

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000169756 Expressed in 207 organ(s), highest expression level in endometrium
ExpressionAtlasiP48059 baseline and differential
GenevisibleiP48059 HS

Family and domain databases

InterProiView protein in InterPro
IPR017351 PINCH
IPR001781 Znf_LIM
PANTHERiPTHR24210 PTHR24210, 1 hit
PfamiView protein in Pfam
PF00412 LIM, 5 hits
PIRSFiPIRSF038003 PINCH, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 5 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 4 hits
PS50023 LIM_DOMAIN_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIMS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P48059
Secondary accession number(s): B2RAJ4
, B7Z483, B7Z7R3, B7Z907, Q53TE0, Q9BS44
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: February 13, 2019
This is version 192 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again