Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fos-related antigen 2

Gene

Fosl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Controls osteoclast survival and size. As a dimer with JUN, activates LIF transcription. Activates CEBPB transcription in PGE2-activated osteoblasts (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

  • keratinocyte development Source: MGI
  • positive regulation of fibroblast proliferation Source: MGI
  • positive regulation of transcription, DNA-templated Source: CACAO
  • positive regulation of transcription by RNA polymerase II Source: MGI
  • response to estradiol Source: MGI
  • response to hypoxia Source: MGI
  • transcription by RNA polymerase II Source: MGI

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Fos-related antigen 2
Short name:
FRA-2
Gene namesi
Name:Fosl2
Synonyms:Fra-2, Fra2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:102858 Fosl2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Mutant pups die within a week after birth. They exhibit severe osteopenia as early as 18.5 dpc, with a 50% decrease in mineralized bone. Osteoblast numbers are not altered. The number, the relative surface covered by osteoclasts and the mean osteoclast surface are increased 3-fold, 5-fold and 2-fold, respectively. Bone resorption activity is increased. This phenotype is due to hypoxia in long bones resulting from placental defects.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000764841 – 326Fos-related antigen 2Add BLAST326

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Cross-linki35Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei104N6-acetyllysine; alternateCombined sources1
Cross-linki104Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei120PhosphoserineBy similarity1
Modified residuei200PhosphoserineBy similarity1
Cross-linki222Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateBy similarity
Cross-linki222Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei230PhosphoserineBy similarity1
Cross-linki239Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei308PhosphoserineBy similarity1
Modified residuei320PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP47930
MaxQBiP47930
PaxDbiP47930
PeptideAtlasiP47930
PRIDEiP47930

PTM databases

iPTMnetiP47930
PhosphoSitePlusiP47930

Expressioni

Gene expression databases

BgeeiENSMUSG00000029135
CleanExiMM_FOSL2
GenevisibleiP47930 MM

Interactioni

Subunit structurei

Heterodimer; with JUN.

Protein-protein interaction databases

BioGridi199729, 1 interactor
ELMiP47930
STRINGi10090.ENSMUSP00000031017

Structurei

3D structure databases

ProteinModelPortaliP47930
SMRiP47930
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini124 – 187bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni126 – 128Basic motifPROSITE-ProRule annotation3
Regioni129 – 136Leucine-zipperPROSITE-ProRule annotation8

Sequence similaritiesi

Belongs to the bZIP family. Fos subfamily.Curated

Phylogenomic databases

eggNOGiKOG1414 Eukaryota
ENOG4111CH5 LUCA
GeneTreeiENSGT00730000110541
HOGENOMiHOG000234334
HOVERGENiHBG005743
InParanoidiP47930
KOiK09030
OMAiLVFTYPN
OrthoDBiEOG091G0GGW
TreeFamiTF326301

Family and domain databases

InterProiView protein in InterPro
IPR000837 AP-1
IPR004827 bZIP
IPR029814 Fra2
PANTHERiPTHR23351 PTHR23351, 1 hit
PTHR23351:SF25 PTHR23351:SF25, 1 hit
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
PRINTSiPR00042 LEUZIPPRFOS
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P47930-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYQDYPGNFD TSSRGSSGSP AHAESYSSGG GGQQKFRVDM PGSGSAFIPT
60 70 80 90 100
INAITTSQDL QWMVQPTVIT SMSNPYPRSH PYSPLPGLAS VPGHMALPRP
110 120 130 140 150
GVIKTIGTTV GRRRRDEQLS PEEEEKRRIR RERNKLAAAK CRNRRRELTE
160 170 180 190 200
KLQAETEELE EEKSGLQKEI AELQKEKEKL EFMLVAHGPV CKISPEERRS
210 220 230 240 250
PPTSGLQSLR GTGSAVGPVV VKQEPPEEDS PSSSAGMDKT QRSVIKPISI
260 270 280 290 300
AGGGFYGEEP LHTPIVVTST PAITPGTSNL VFTYPNVLEQ ESPSSPSESC
310 320
SKAHRRSSSS GDQSSDSLNS PTLLAL
Length:326
Mass (Da):35,298
Last modified:July 27, 2011 - v2
Checksum:i05B0F20D7D0B790A
GO
Isoform 2 (identifier: P47930-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQ → MSFSLF

Note: No experimental confirmation available.
Show »
Length:299
Mass (Da):32,687
Checksum:i4879B6E93597B61E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti184L → K in CAA58805 (PubMed:7936655).Curated1
Sequence conflicti267V → E in BAE26674 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0420841 – 33MYQDY…GGGGQ → MSFSLF in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X83971 mRNA Translation: CAA58805.1
X83970 Genomic DNA Translation: CAA58804.1
AK089371 mRNA Translation: BAC40860.1
AK145822 mRNA Translation: BAE26674.1
BC065131 mRNA Translation: AAH65131.1
CCDSiCCDS19190.1 [P47930-1]
PIRiI48351
RefSeqiNP_032063.2, NM_008037.4 [P47930-1]
UniGeneiMm.24684

Genome annotation databases

EnsembliENSMUST00000031017; ENSMUSP00000031017; ENSMUSG00000029135 [P47930-1]
GeneIDi14284
KEGGimmu:14284
UCSCiuc008wzi.2 mouse [P47930-1]
uc008wzj.1 mouse [P47930-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFOSL2_MOUSE
AccessioniPrimary (citable) accession number: P47930
Secondary accession number(s): Q3UKX7, Q8C231
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: July 27, 2011
Last modified: July 18, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health