UniProtKB - P47879 (IBP4_MOUSE)

BLAST

>sp|P47879|IBP4_MOUSE Insulin-like growth factor-binding protein 4 OS=Mus musculus OX=10090 GN=Igfbp4 PE=1 SV=2
MLPFGLVAALLLAAGPRPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGMRCYPPRGVEKPLRTLMHGQGVCTELSEIEAIQESLQTSDKDE
SEHPNNSFNPCSAHDHRCLQKHMAKIRDRSKMKIVGTPREEPRPVPQGSCQSELHRALER
LAASQSRTHEDLFIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPK
GELDCHQLADSFQE

Align
Format
Add to basket Added to basket
History
Entry version 146 (12 Sep 2018)
Sequence version 2 (15 Jul 1998)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Insulin-like growth factor-binding protein 4

Gene

Igfbp4

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

GO - Molecular functionⁱ

insulin-like growth factor binding
Source: MGI
Inferred from physical interactionⁱ
- 7679139
insulin-like growth factor I binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
insulin-like growth factor II binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Growth factor binding

Molecular function

Growth factor binding

Enzyme and pathway databases

Reactomeⁱ	R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) R-MMU-8957275 Post-translational protein phosphorylation

Reactomeⁱ

R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-8957275 Post-translational protein phosphorylation

Protein family/group databases

MEROPS protease database More...MEROPSⁱ	I31.952

MEROPSⁱ

I31.952

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Insulin-like growth factor-binding protein 4 Short name: IBP-4 Short name: IGF-binding protein 4 Short name: IGFBP-4
Gene namesⁱ	Name:Igfbp4 Synonyms:Igfbp-4
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 11

Organism-specific databases

MGIⁱ	MGI:96439 Igfbp4

Keywords - Cellular componentⁱ

Secreted

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 21	By similarityAdd BLAST		21
ChainⁱPRO_0000014383	22 – 254	Insulin-like growth factor-binding protein 4Add BLAST		233

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	27 ↔ 53	PROSITE-ProRule annotation
Disulfide bondⁱ	30 ↔ 55	PROSITE-ProRule annotation
Disulfide bondⁱ	38 ↔ 59	PROSITE-ProRule annotation
Disulfide bondⁱ	44 ↔ 56	PROSITE-ProRule annotation
Disulfide bondⁱ	67 ↔ 80	PROSITE-ProRule annotation
Disulfide bondⁱ	74 ↔ 100	PROSITE-ProRule annotation
Glycosylationⁱ	125	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	131 ↔ 138	PROSITE-ProRule annotation
Disulfide bondⁱ	170 ↔ 200	PROSITE-ProRule annotation
Disulfide bondⁱ	211 ↔ 222	PROSITE-ProRule annotation
Disulfide bondⁱ	224 ↔ 245	PROSITE-ProRule annotation
Modified residueⁱ	251	PhosphoserineBy similarity	1

Keywords - PTMⁱ

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDⁱ	P47879
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P47879
PaxDbⁱ	P47879
PeptideAtlas More...PeptideAtlasⁱ	P47879
PRIDEⁱ	P47879

PTM databases

iPTMnetⁱ	P47879
PhosphoSitePlusⁱ	P47879
SwissPalmⁱ	P47879

Miscellaneous databases

PMAP-CutDBⁱ	P47879

PMAP-CutDBⁱ

P47879

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000017493 Expressed in 294 organ(s), highest expression level in external carotid artery
CleanExⁱ	MM_IGFBP4
ExpressionAtlasⁱ	P47879 baseline and differential
Genevisibleⁱ	P47879 MM

Interactionⁱ

Subunit structureⁱ

Binds IGF2 more than IGF1.

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
Fzd8	Q61091	3	EBI-15706768,EBI-6171689
LRP6	O75581	4	EBI-15706768,EBI-910915	From Homo sapiens.

GO - Molecular functionⁱ

insulin-like growth factor binding
Source: MGI
Inferred from physical interactionⁱ
- 7679139
insulin-like growth factor I binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
insulin-like growth factor II binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

Database of interacting proteins More...DIPⁱ	DIP-60633N
IntActⁱ	P47879, 2 interactors
STRINGⁱ	10090.ENSMUSP00000017637

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P47879
SMRⁱ	P47879
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	23 – 103	IGFBP N-terminalPROSITE-ProRule annotationAdd BLAST		81
Domainⁱ	167 – 245	Thyroglobulin type-1PROSITE-ProRule annotationAdd BLAST		79

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	ENOG410IKZ1 Eukaryota ENOG4111HXV LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00550000074457
HOGENOMⁱ	HOG000253012
HOVERGENⁱ	HBG002631
InParanoidⁱ	P47879
OMAⁱ	KGMPCGV
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0EIN
PhylomeDBⁱ	P47879
TreeFamⁱ	TF331211

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00191 TY, 1 hit
Gene3Dⁱ	4.10.800.10, 1 hit
InterProⁱ	View protein in InterPro IPR009030 Growth_fac_rcpt_cys_sf IPR022327 IGFBP-4 IPR000867 IGFBP-like IPR009168 IGFBP1-6 IPR022321 IGFBP_1-6_chordata IPR017891 Insulin_GF-bd_Cys-rich_CS IPR000716 Thyroglobulin_1 IPR036857 Thyroglobulin_1_sf
PANTHERⁱ	PTHR11551 PTHR11551, 1 hit PTHR11551:SF7 PTHR11551:SF7, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00219 IGFBP, 1 hit PF00086 Thyroglobulin_1, 1 hit
PRINTSⁱ	PR01976 IGFBPFAMILY PR01980 IGFBPFAMILY4
SMARTⁱ	View protein in SMART SM00121 IB, 1 hit SM00211 TY, 1 hit
SUPFAMⁱ	SSF57184 SSF57184, 1 hit SSF57610 SSF57610, 1 hit
PROSITEⁱ	View protein in PROSITE PS00222 IGFBP_N_1, 1 hit PS51323 IGFBP_N_2, 1 hit PS00484 THYROGLOBULIN_1_1, 1 hit PS51162 THYROGLOBULIN_1_2, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

P47879-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLPFGLVAAL LLAAGPRPSL GDEAIHCPPC SEEKLARCRP PVGCEELVRE 
        60         70         80         90        100
PGCGCCATCA LGLGMPCGVY TPRCGSGMRC YPPRGVEKPL RTLMHGQGVC 
       110        120        130        140        150
TELSEIEAIQ ESLQTSDKDE SEHPNNSFNP CSAHDHRCLQ KHMAKIRDRS 
       160        170        180        190        200
KMKIVGTPRE EPRPVPQGSC QSELHRALER LAASQSRTHE DLFIIPIPNC 
       210        220        230        240        250
DRNGNFHPKQ CHPALDGQRG KCWCVDRKTG VKLPGGLEPK GELDCHQLAD 

SFQE

Length:254

Mass (Da):27,807

Last modified:July 15, 1998 - v2

Checksum:ⁱ58EF89CB514AEE17

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

H3BLB7	H3BLB7_MOUSE	Insulin-like growth factor-binding ... Insulin-like growth factor-binding protein 4	Igfbp4	161	Annotation score:
H3BJT2	H3BJT2_MOUSE	Insulin-like growth factor-binding ... Insulin-like growth factor-binding protein 4	Igfbp4	122	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	4 – 5	FG → CS in CAA57272 (PubMed:7529732).Curated	2
Sequence conflictⁱ	13	A → T in CAA57272 (PubMed:7529732).Curated	1
Sequence conflictⁱ	56	C → S in CAA57272 (PubMed:7529732).Curated	1
Sequence conflictⁱ	67	C → G in CAA57272 (PubMed:7529732).Curated	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X81582 mRNA Translation: CAA57272.1 X76066 Genomic DNA Translation: CAA53667.1 AK150229 mRNA Translation: BAE29395.1 AK165688 mRNA Translation: BAE38340.1 BC019836 mRNA Translation: AAH19836.1 Z95492 Genomic DNA Translation: CAB08859.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS25371.1
PIRⁱ	I48599 I48603
NCBI Reference Sequences More...RefSeqⁱ	NP_034647.1, NM_010517.3
UniGeneⁱ	Mm.233799

Genome annotation databases

Ensemblⁱ	ENSMUST00000017637; ENSMUSP00000017637; ENSMUSG00000017493
GeneIDⁱ	16010
KEGGⁱ	mmu:16010
UCSC genome browser More...UCSCⁱ	uc007lie.1 mouse

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P47879	Insulin-like growth factor-binding protein 4	)	HUMAN		258	UniRef90_P22692
Insulin-like growth factor-binding protein 4		PIG		259
Insulin-like growth factor-binding protein 4		BOVIN		258
Insulin-like growth factor-binding protein 4		RAT		254
Insulin-like growth factor-binding protein 4		MACMU		258
+110

Protein	Similar proteins		Species	Score	Length	Source
P47879	Insulin-like growth factor-binding protein 4	)	HUMAN		258	UniRef50_P22692
Insulin-like growth factor-binding protein 4		PIG		259
Insulin-like growth factor-binding protein 4		BOVIN		258
Insulin-like growth factor-binding protein 4		RAT		254
Insulin-like growth factor-binding protein 4		MACMU		258
+111

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X81582 mRNA Translation: CAA57272.1 X76066 Genomic DNA Translation: CAA53667.1 AK150229 mRNA Translation: BAE29395.1 AK165688 mRNA Translation: BAE38340.1 BC019836 mRNA Translation: AAH19836.1 Z95492 Genomic DNA Translation: CAB08859.1
CCDSⁱ	CCDS25371.1
PIRⁱ	I48599 I48603
RefSeqⁱ	NP_034647.1, NM_010517.3
UniGeneⁱ	Mm.233799

3D structure databases

ProteinModelPortalⁱ	P47879
SMRⁱ	P47879
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

DIPⁱ	DIP-60633N
IntActⁱ	P47879, 2 interactors
STRINGⁱ	10090.ENSMUSP00000017637

Protein family/group databases

MEROPSⁱ	I31.952

MEROPSⁱ

I31.952

PTM databases

iPTMnetⁱ	P47879
PhosphoSitePlusⁱ	P47879
SwissPalmⁱ	P47879

Proteomic databases

EPDⁱ	P47879
MaxQBⁱ	P47879
PaxDbⁱ	P47879
PeptideAtlasⁱ	P47879
PRIDEⁱ	P47879

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000017637; ENSMUSP00000017637; ENSMUSG00000017493
GeneIDⁱ	16010
KEGGⁱ	mmu:16010
UCSCⁱ	uc007lie.1 mouse

Organism-specific databases

CTDⁱ	3487
MGIⁱ	MGI:96439 Igfbp4

Phylogenomic databases

eggNOGⁱ	ENOG410IKZ1 Eukaryota ENOG4111HXV LUCA
GeneTreeⁱ	ENSGT00550000074457
HOGENOMⁱ	HOG000253012
HOVERGENⁱ	HBG002631
InParanoidⁱ	P47879
OMAⁱ	KGMPCGV
OrthoDBⁱ	EOG091G0EIN
PhylomeDBⁱ	P47879
TreeFamⁱ	TF331211

Enzyme and pathway databases

Reactomeⁱ	R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) R-MMU-8957275 Post-translational protein phosphorylation

Reactomeⁱ

R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-8957275 Post-translational protein phosphorylation

Miscellaneous databases

ChiTaRSⁱ	Igfbp4 mouse
PMAP-CutDBⁱ	P47879
Protein Ontology More...PROⁱ	PR:P47879
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000017493 Expressed in 294 organ(s), highest expression level in external carotid artery
CleanExⁱ	MM_IGFBP4
ExpressionAtlasⁱ	P47879 baseline and differential
Genevisibleⁱ	P47879 MM

Family and domain databases

CDDⁱ	cd00191 TY, 1 hit
Gene3Dⁱ	4.10.800.10, 1 hit
InterProⁱ	View protein in InterPro IPR009030 Growth_fac_rcpt_cys_sf IPR022327 IGFBP-4 IPR000867 IGFBP-like IPR009168 IGFBP1-6 IPR022321 IGFBP_1-6_chordata IPR017891 Insulin_GF-bd_Cys-rich_CS IPR000716 Thyroglobulin_1 IPR036857 Thyroglobulin_1_sf
PANTHERⁱ	PTHR11551 PTHR11551, 1 hit PTHR11551:SF7 PTHR11551:SF7, 1 hit
Pfamⁱ	View protein in Pfam PF00219 IGFBP, 1 hit PF00086 Thyroglobulin_1, 1 hit
PRINTSⁱ	PR01976 IGFBPFAMILY PR01980 IGFBPFAMILY4
SMARTⁱ	View protein in SMART SM00121 IB, 1 hit SM00211 TY, 1 hit
SUPFAMⁱ	SSF57184 SSF57184, 1 hit SSF57610 SSF57610, 1 hit
PROSITEⁱ	View protein in PROSITE PS00222 IGFBP_N_1, 1 hit PS51323 IGFBP_N_2, 1 hit PS00484 THYROGLOBULIN_1_1, 1 hit PS51162 THYROGLOBULIN_1_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	IBP4_MOUSE
Accessionⁱ	P47879Primary (citable) accession number: P47879 Secondary accession number(s): O35666, Q3TMV0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1996
	Last sequence update:	July 15, 1998
	Last modified:	September 12, 2018
	This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P47879 (IBP4_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Insulin-like growth factor-binding protein 4

Igfbp4

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Extracellular region or secreted

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

Miscellaneous databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protein family/group databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ