Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gamma-aminobutyric acid receptor subunit alpha-2

Gene

GABRA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.

GO - Molecular functioni

  • benzodiazepine receptor activity Source: UniProtKB
  • GABA-A receptor activity Source: InterPro
  • GABA-gated chloride ion channel activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionChloride channel, Ion channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport
LigandChloride

Enzyme and pathway databases

ReactomeiR-HSA-112314 Neurotransmitter receptors and postsynaptic signal transmission
R-HSA-977441 GABA A receptor activation

Protein family/group databases

TCDBi1.A.9.5.2 the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family

Names & Taxonomyi

Protein namesi
Recommended name:
Gamma-aminobutyric acid receptor subunit alpha-2
Alternative name(s):
GABA(A) receptor subunit alpha-2
Gene namesi
Name:GABRA2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000151834.15
HGNCiHGNC:4076 GABRA2
MIMi137140 gene
neXtProtiNX_P47869

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini29 – 251ExtracellularCuratedAdd BLAST223
Transmembranei252 – 273HelicalCuratedAdd BLAST22
Transmembranei279 – 300HelicalCuratedAdd BLAST22
Transmembranei313 – 334HelicalCuratedAdd BLAST22
Topological domaini335 – 419CytoplasmicCuratedAdd BLAST85
Transmembranei420 – 441HelicalCuratedAdd BLAST22

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi2555
MalaCardsiGABRA2
MIMi103780 phenotype
OpenTargetsiENSG00000151834
PharmGKBiPA28490

Chemistry databases

ChEMBLiCHEMBL4956
DrugBankiDB00659 Acamprosate
DB00546 Adinazolam
DB06579 Adipiplon
DB00404 Alprazolam
DB01351 Amobarbital
DB00543 Amoxapine
DB01352 Aprobarbital
DB01483 Barbital
DB01496 Barbituric acid derivative
DB01558 Bromazepam
DB00237 Butabarbital
DB00241 Butalbital
DB01353 Butethal
DB00475 Chlordiazepoxide
DB01594 Cinolazepam
DB00349 Clobazam
DB01068 Clonazepam
DB00628 Clorazepate
DB01559 Clotiazepam
DB01189 Desflurane
DB00829 Diazepam
DB00228 Enflurane
DB01049 Ergoloid mesylate
DB01215 Estazolam
DB00402 Eszopiclone
DB00898 Ethanol
DB00189 Ethchlorvynol
DB00292 Etomidate
DB01567 Fludiazepam
DB01205 Flumazenil
DB01544 Flunitrazepam
DB00690 Flurazepam
DB05087 Ganaxolone
DB01437 Glutethimide
DB00801 Halazepam
DB01159 Halothane
DB01354 Heptabarbital
DB01355 Hexobarbital
DB00753 Isoflurane
DB00186 Lorazepam
DB00371 Meprobamate
DB00463 Metharbital
DB01028 Methoxyflurane
DB00849 Methylphenobarbital
DB01107 Methyprylon
DB00683 Midazolam
DB01595 Nitrazepam
DB00334 Olanzapine
DB00842 Oxazepam
DB04903 Pagoclone
DB00312 Pentobarbital
DB01708 Prasterone
DB01588 Prazepam
DB00794 Primidone
DB00818 Propofol
DB01589 Quazepam
DB01346 Quinidine barbiturate
DB00418 Secobarbital
DB01236 Sevoflurane
DB00306 Talbutal
DB00231 Temazepam
DB11582 Thiocolchicoside
DB00599 Thiopental
DB00273 Topiramate
DB00897 Triazolam
DB00425 Zolpidem
DB01198 Zopiclone
GuidetoPHARMACOLOGYi405

Polymorphism and mutation databases

BioMutaiGABRA2
DMDMi126302547

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 28Sequence analysisAdd BLAST28
ChainiPRO_000000043329 – 451Gamma-aminobutyric acid receptor subunit alpha-2Add BLAST423

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi38N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi138N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi166 ↔ 180By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP47869
PeptideAtlasiP47869
PRIDEiP47869
ProteomicsDBi55800

PTM databases

iPTMnetiP47869
PhosphoSitePlusiP47869

Expressioni

Gene expression databases

BgeeiENSG00000151834 Expressed in 133 organ(s), highest expression level in amygdala
CleanExiHS_GABRA2
ExpressionAtlasiP47869 baseline and differential
GenevisibleiP47869 HS

Organism-specific databases

HPAiCAB079061

Interactioni

Subunit structurei

Generally pentameric. There are five types of GABA(A) receptor chains: alpha, beta, gamma, delta, and rho. Interacts with UBQLN1. Interacts with KIF21B.By similarity

Protein-protein interaction databases

BioGridi108829, 1 interactor
ComplexPortaliCPX-2174 GABA-A receptor, alpha-2/beta-3/gamma-2
IntActiP47869, 1 interactor
STRINGi9606.ENSP00000348897

Chemistry databases

BindingDBiP47869

Structurei

3D structure databases

ProteinModelPortaliP47869
SMRiP47869
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3642 Eukaryota
ENOG410XNQG LUCA
GeneTreeiENSGT00760000119010
HOGENOMiHOG000231337
HOVERGENiHBG051707
InParanoidiP47869
KOiK05175
PhylomeDBiP47869
TreeFamiTF315453

Family and domain databases

Gene3Di2.70.170.10, 1 hit
InterProiView protein in InterPro
IPR006028 GABAA/Glycine_rcpt
IPR001390 GABAAa_rcpt
IPR005432 GABBAa2_rcpt
IPR006202 Neur_chan_lig-bd
IPR036734 Neur_chan_lig-bd_sf
IPR006201 Neur_channel
IPR036719 Neuro-gated_channel_TM_sf
IPR006029 Neurotrans-gated_channel_TM
IPR018000 Neurotransmitter_ion_chnl_CS
PANTHERiPTHR18945 PTHR18945, 1 hit
PTHR18945:SF218 PTHR18945:SF218, 1 hit
PfamiView protein in Pfam
PF02931 Neur_chan_LBD, 1 hit
PF02932 Neur_chan_memb, 1 hit
PRINTSiPR01079 GABAARALPHA
PR01615 GABAARALPHA2
PR00253 GABAARECEPTR
PR00252 NRIONCHANNEL
SUPFAMiSSF63712 SSF63712, 1 hit
SSF90112 SSF90112, 1 hit
TIGRFAMsiTIGR00860 LIC, 1 hit
PROSITEiView protein in PROSITE
PS00236 NEUROTR_ION_CHANNEL, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 9 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: P47869-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKTKLNIYNM QFLLFVFLVW DPARLVLANI QEDEAKNNIT IFTRILDRLL
60 70 80 90 100
DGYDNRLRPG LGDSITEVFT NIYVTSFGPV SDTDMEYTID VFFRQKWKDE
110 120 130 140 150
RLKFKGPMNI LRLNNLMASK IWTPDTFFHN GKKSVAHNMT MPNKLLRIQD
160 170 180 190 200
DGTLLYTMRL TVQAECPMHL EDFPMDAHSC PLKFGSYAYT TSEVTYIWTY
210 220 230 240 250
NASDSVQVAP DGSRLNQYDL LGQSIGKETI KSSTGEYTVM TAHFHLKRKI
260 270 280 290 300
GYFVIQTYLP CIMTVILSQV SFWLNRESVP ARTVFGVTTV LTMTTLSISA
310 320 330 340 350
RNSLPKVAYA TAMDWFIAVC YAFVFSALIE FATVNYFTKR GWAWDGKSVV
360 370 380 390 400
NDKKKEKASV MIQNNAYAVA VANYAPNLSK DPVLSTISKS ATTPEPNKKP
410 420 430 440 450
ENKPAEAKKT FNSVSKIDRM SRIVFPVLFG TFNLVYWATY LNREPVLGVS

P
Length:451
Mass (Da):51,326
Last modified:February 20, 2007 - v2
Checksum:i43F9F708B5A00FFD
GO
Isoform 2 (identifier: P47869-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MKTKLNIYNM...SFGPVSDTDM → MRLKITLPSLREFLTDFWMVTIIGLDQDWE
     353-353: K → KSPSIKAEGITLTYNSVKAILQGAKLIWSKYIAFSWPSLFQEKTLEYLEKWMDCLTFKQSS

Note: No experimental confirmation available.
Show »
Length:456
Mass (Da):52,064
Checksum:i040306CCB7836206
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PBQ7E9PBQ7_HUMAN
Gamma-aminobutyric acid receptor su...
GABRA2
511Annotation score:
G5E9Z6G5E9Z6_HUMAN
Gamma-aminobutyric acid (GABA) A re...
GABRA2 hCG_15318
367Annotation score:
A0A0A0MTM5A0A0A0MTM5_HUMAN
Gamma-aminobutyric acid receptor su...
GABRA2
427Annotation score:
D6RBK9D6RBK9_HUMAN
Gamma-aminobutyric acid receptor su...
GABRA2
159Annotation score:
D6RB77D6RB77_HUMAN
Gamma-aminobutyric acid receptor su...
GABRA2
151Annotation score:
D6RBL7D6RBL7_HUMAN
Gamma-aminobutyric acid receptor su...
GABRA2
137Annotation score:
D6RCS5D6RCS5_HUMAN
Gamma-aminobutyric acid A receptor ...
GABRA2
66Annotation score:
D6RAA9D6RAA9_HUMAN
Gamma-aminobutyric acid receptor su...
GABRA2
73Annotation score:
H0Y9V8H0Y9V8_HUMAN
Gamma-aminobutyric acid receptor su...
GABRA2
56Annotation score:

Sequence cautioni

The sequence BAD92532 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti10 – 11MQ → IE in AAB27278 (PubMed:8391122).Curated2
Sequence conflicti343A → T in AAB27278 (PubMed:8391122).Curated1

Polymorphismi

Genetic variations in GABRA2 determine the genetic susceptibility to alcoholism [MIMi:103780].

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0542771 – 85MKTKL…SDTDM → MRLKITLPSLREFLTDFWMV TIIGLDQDWE in isoform 2. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_054278353K → KSPSIKAEGITLTYNSVKAI LQGAKLIWSKYIAFSWPSLF QEKTLEYLEKWMDCLTFKQS S in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S62907 mRNA Translation: AAB27278.1
AK125179 mRNA Translation: BAG54159.1
AK289662 mRNA Translation: BAF82351.1
AK293466 mRNA Translation: BAH11514.1
AB209295 mRNA Translation: BAD92532.1 Different initiation.
AC084352 Genomic DNA No translation available.
AC093745 Genomic DNA No translation available.
AC095060 Genomic DNA No translation available.
AC104072 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW93022.1
CCDSiCCDS3471.1 [P47869-1]
PIRiI57947
RefSeqiNP_000798.2, NM_000807.3 [P47869-1]
NP_001107647.1, NM_001114175.2 [P47869-1]
NP_001273756.1, NM_001286827.2 [P47869-2]
NP_001317619.1, NM_001330690.1
XP_016863471.1, XM_017007982.1 [P47869-1]
XP_016863472.1, XM_017007983.1 [P47869-1]
UniGeneiHs.116250
Hs.48372

Genome annotation databases

EnsembliENST00000356504; ENSP00000348897; ENSG00000151834 [P47869-1]
ENST00000381620; ENSP00000371033; ENSG00000151834 [P47869-1]
ENST00000510861; ENSP00000421828; ENSG00000151834 [P47869-1]
ENST00000514090; ENSP00000421300; ENSG00000151834 [P47869-1]
GeneIDi2555
KEGGihsa:2555
UCSCiuc003gxc.5 human [P47869-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Protein Spotlight

Forbidden fruit - Issue 56 of March 2005

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S62907 mRNA Translation: AAB27278.1
AK125179 mRNA Translation: BAG54159.1
AK289662 mRNA Translation: BAF82351.1
AK293466 mRNA Translation: BAH11514.1
AB209295 mRNA Translation: BAD92532.1 Different initiation.
AC084352 Genomic DNA No translation available.
AC093745 Genomic DNA No translation available.
AC095060 Genomic DNA No translation available.
AC104072 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW93022.1
CCDSiCCDS3471.1 [P47869-1]
PIRiI57947
RefSeqiNP_000798.2, NM_000807.3 [P47869-1]
NP_001107647.1, NM_001114175.2 [P47869-1]
NP_001273756.1, NM_001286827.2 [P47869-2]
NP_001317619.1, NM_001330690.1
XP_016863471.1, XM_017007982.1 [P47869-1]
XP_016863472.1, XM_017007983.1 [P47869-1]
UniGeneiHs.116250
Hs.48372

3D structure databases

ProteinModelPortaliP47869
SMRiP47869
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108829, 1 interactor
ComplexPortaliCPX-2174 GABA-A receptor, alpha-2/beta-3/gamma-2
IntActiP47869, 1 interactor
STRINGi9606.ENSP00000348897

Chemistry databases

BindingDBiP47869
ChEMBLiCHEMBL4956
DrugBankiDB00659 Acamprosate
DB00546 Adinazolam
DB06579 Adipiplon
DB00404 Alprazolam
DB01351 Amobarbital
DB00543 Amoxapine
DB01352 Aprobarbital
DB01483 Barbital
DB01496 Barbituric acid derivative
DB01558 Bromazepam
DB00237 Butabarbital
DB00241 Butalbital
DB01353 Butethal
DB00475 Chlordiazepoxide
DB01594 Cinolazepam
DB00349 Clobazam
DB01068 Clonazepam
DB00628 Clorazepate
DB01559 Clotiazepam
DB01189 Desflurane
DB00829 Diazepam
DB00228 Enflurane
DB01049 Ergoloid mesylate
DB01215 Estazolam
DB00402 Eszopiclone
DB00898 Ethanol
DB00189 Ethchlorvynol
DB00292 Etomidate
DB01567 Fludiazepam
DB01205 Flumazenil
DB01544 Flunitrazepam
DB00690 Flurazepam
DB05087 Ganaxolone
DB01437 Glutethimide
DB00801 Halazepam
DB01159 Halothane
DB01354 Heptabarbital
DB01355 Hexobarbital
DB00753 Isoflurane
DB00186 Lorazepam
DB00371 Meprobamate
DB00463 Metharbital
DB01028 Methoxyflurane
DB00849 Methylphenobarbital
DB01107 Methyprylon
DB00683 Midazolam
DB01595 Nitrazepam
DB00334 Olanzapine
DB00842 Oxazepam
DB04903 Pagoclone
DB00312 Pentobarbital
DB01708 Prasterone
DB01588 Prazepam
DB00794 Primidone
DB00818 Propofol
DB01589 Quazepam
DB01346 Quinidine barbiturate
DB00418 Secobarbital
DB01236 Sevoflurane
DB00306 Talbutal
DB00231 Temazepam
DB11582 Thiocolchicoside
DB00599 Thiopental
DB00273 Topiramate
DB00897 Triazolam
DB00425 Zolpidem
DB01198 Zopiclone
GuidetoPHARMACOLOGYi405

Protein family/group databases

TCDBi1.A.9.5.2 the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family

PTM databases

iPTMnetiP47869
PhosphoSitePlusiP47869

Polymorphism and mutation databases

BioMutaiGABRA2
DMDMi126302547

Proteomic databases

PaxDbiP47869
PeptideAtlasiP47869
PRIDEiP47869
ProteomicsDBi55800

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356504; ENSP00000348897; ENSG00000151834 [P47869-1]
ENST00000381620; ENSP00000371033; ENSG00000151834 [P47869-1]
ENST00000510861; ENSP00000421828; ENSG00000151834 [P47869-1]
ENST00000514090; ENSP00000421300; ENSG00000151834 [P47869-1]
GeneIDi2555
KEGGihsa:2555
UCSCiuc003gxc.5 human [P47869-1]

Organism-specific databases

CTDi2555
DisGeNETi2555
EuPathDBiHostDB:ENSG00000151834.15
GeneCardsiGABRA2
HGNCiHGNC:4076 GABRA2
HPAiCAB079061
MalaCardsiGABRA2
MIMi103780 phenotype
137140 gene
neXtProtiNX_P47869
OpenTargetsiENSG00000151834
PharmGKBiPA28490
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3642 Eukaryota
ENOG410XNQG LUCA
GeneTreeiENSGT00760000119010
HOGENOMiHOG000231337
HOVERGENiHBG051707
InParanoidiP47869
KOiK05175
PhylomeDBiP47869
TreeFamiTF315453

Enzyme and pathway databases

ReactomeiR-HSA-112314 Neurotransmitter receptors and postsynaptic signal transmission
R-HSA-977441 GABA A receptor activation

Miscellaneous databases

ChiTaRSiGABRA2 human
GeneWikiiGABRA2
GenomeRNAii2555
PROiPR:P47869
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151834 Expressed in 133 organ(s), highest expression level in amygdala
CleanExiHS_GABRA2
ExpressionAtlasiP47869 baseline and differential
GenevisibleiP47869 HS

Family and domain databases

Gene3Di2.70.170.10, 1 hit
InterProiView protein in InterPro
IPR006028 GABAA/Glycine_rcpt
IPR001390 GABAAa_rcpt
IPR005432 GABBAa2_rcpt
IPR006202 Neur_chan_lig-bd
IPR036734 Neur_chan_lig-bd_sf
IPR006201 Neur_channel
IPR036719 Neuro-gated_channel_TM_sf
IPR006029 Neurotrans-gated_channel_TM
IPR018000 Neurotransmitter_ion_chnl_CS
PANTHERiPTHR18945 PTHR18945, 1 hit
PTHR18945:SF218 PTHR18945:SF218, 1 hit
PfamiView protein in Pfam
PF02931 Neur_chan_LBD, 1 hit
PF02932 Neur_chan_memb, 1 hit
PRINTSiPR01079 GABAARALPHA
PR01615 GABAARALPHA2
PR00253 GABAARECEPTR
PR00252 NRIONCHANNEL
SUPFAMiSSF63712 SSF63712, 1 hit
SSF90112 SSF90112, 1 hit
TIGRFAMsiTIGR00860 LIC, 1 hit
PROSITEiView protein in PROSITE
PS00236 NEUROTR_ION_CHANNEL, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGBRA2_HUMAN
AccessioniPrimary (citable) accession number: P47869
Secondary accession number(s): A8K0U7, B7Z1H8, Q59G14
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 20, 2007
Last modified: September 12, 2018
This is version 174 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again