Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P47756 (CAPZB_HUMAN)

Entry version 203 (02 Dec 2020)
Sequence version 4 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

F-actin-capping protein subunit beta

Gene

CAPZB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin capping, Actin-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P47756

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2132295, MHC class II antigen presentation
R-HSA-3371497, HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-6807878, COPI-mediated anterograde transport
R-HSA-6811436, COPI-independent Golgi-to-ER retrograde traffic
R-HSA-983231, Factors involved in megakaryocyte development and platelet production

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
F-actin-capping protein subunit beta
Alternative name(s):
CapZ beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CAPZB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000077549.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:1491, CAPZB

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601572, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P47756

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		832

Open Targets

More...OpenTargetsi		ENSG00000077549

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26072

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P47756, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4295764

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CAPZB

Domain mapping of disease mutations (DMDM)

More...DMDMi		13124696

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002046342 – 277F-actin-capping protein subunit betaAdd BLAST276

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1 Publication1
Modified residuei2PhosphoserineCombined sources1
Modified residuei235N6-acetyllysineCombined sources1
Modified residuei263PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P47756

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P47756

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P47756

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P47756

PeptideAtlas

More...PeptideAtlasi		P47756

PRoteomics IDEntifications database

More...PRIDEi		P47756

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55793 [P47756-1]
55794 [P47756-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P47756-2 [P47756-2]

2D gel databases

DOSAC-COBS 2D-PAGE database

More...DOSAC-COBS-2DPAGEi		P47756

USC-OGP 2-DE database

More...OGPi		P47756

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00026185

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...SWISS-2DPAGEi		P47756

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		P47756

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P47756

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P47756

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P47756

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P47756

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000077549, Expressed in smooth muscle tissue and 249 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P47756, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P47756, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000077549, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit.

Interacts with ARHGAP17 (PubMed:16678097). Interaction with RCSD1/CAPZIP (PubMed:15850461).

Component of the WASH complex, composed of F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH (WASHC1, WASH2P, WASH3P, WASH4P, WASH5P or WASH6P), WASHC2 (WASHC2A or WASHC2C), WASHC3, WASHC4 and WASHC5 (PubMed:19922875).

Interacts with ACTG1 (PubMed:28493397). Directly interacts with CRACD; this interaction decreases binding to actin (PubMed:30361697).

5 Publications

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107282, 237 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P47756

Protein interaction database and analysis system

More...IntActi		P47756, 100 interactors

Molecular INTeraction database

More...MINTi		P47756

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000401010

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P47756, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P47756

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the F-actin-capping protein beta subunit family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3174, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000017957

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_045864_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P47756

Identification of Orthologs from Complete Genome Data

More...OMAi		GRQAHYK

Database of Orthologous Groups

More...OrthoDBi		1076134at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P47756

TreeFam database of animal gene trees

More...TreeFami		TF105732

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.58.570, 1 hit
2.40.160.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR037282, CapZ_alpha/beta
IPR042276, CapZ_alpha/beta_2
IPR001698, CAPZB
IPR043175, CAPZB_N
IPR019771, F-actin_capping_bsu_CS

The PANTHER Classification System

More...PANTHERi		PTHR10619, PTHR10619, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01115, F_actin_cap_B, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00192, FACTINCAPB

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF90096, SSF90096, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00231, F_ACTIN_CAPPING_BETA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P47756-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDQQLDCAL DLMRRLPPQQ IEKNLSDLID LVPSLCEDLL SSVDQPLKIA 
        60         70         80         90        100
RDKVVGKDYL LCDYNRDGDS YRSPWSNKYD PPLEDGAMPS ARLRKLEVEA 
       110        120        130        140        150
NNAFDQYRDL YFEGGVSSVY LWDLDHGFAG VILIKKAGDG SKKIKGCWDS 
       160        170        180        190        200
IHVVEVQEKS SGRTAHYKLT STVMLWLQTN KSGSGTMNLG GSLTRQMEKD 
       210        220        230        240        250
ETVSDCSPHI ANIGRLVEDM ENKIRSTLNE IYFGKTKDIV NGLRSIDAIP 
       260        270 
DNQKFKQLQR ELSQVLTQRQ IYIQPDN
Length:277
Mass (Da):31,350
Last modified:January 23, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iABA1621F9E0152A6
GO
Isoform 2 (identifier: P47756-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-277: IDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN → VQTFADKSKQEALKNDLVEALKRKQQC

Show »
Length:272
Mass (Da):30,629
Checksum:iE6466A68B1254FD0
GO
Isoform 3 (identifier: P47756-3)
Sequence is not available
Length:–
Mass (Da):–

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AK88B1AK88_HUMAN
F-actin-capping protein subunit bet...
CAPZB hCG_41078
301Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AK87B1AK87_HUMAN
F-actin-capping protein subunit bet...
CAPZB
244Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AK85B1AK85_HUMAN
F-actin-capping protein subunit bet...
CAPZB
260Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A6I8PRV6A0A6I8PRV6_HUMAN
F-actin-capping protein subunit bet...
CAPZB
59Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A6I8PIN8A0A6I8PIN8_HUMAN
CapZ beta
CAPZB
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A6I8PIH4A0A6I8PIH4_HUMAN
F-actin-capping protein subunit bet...
CAPZB
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000767246 – 277IDAIP…IQPDN → VQTFADKSKQEALKNDLVEA LKRKQQC in isoform 2. 3 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U03271 mRNA Translation: AAA87395.1
BT019470 mRNA Translation: AAV38277.1
BT019471 mRNA Translation: AAV38278.1
AL035413 Genomic DNA No translation available.
AL359199 Genomic DNA No translation available.
AL445163 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW94890.1
BC024601 mRNA Translation: AAH24601.1
BC107752 mRNA Translation: AAI07753.1
BC109241 mRNA Translation: AAI09242.1
BC109242 mRNA Translation: AAI09243.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41277.1 [P47756-2]
CCDS55579.1 [P47756-1]

NCBI Reference Sequences

More...RefSeqi		NP_001193469.1, NM_001206540.2 [P47756-1]
NP_001269091.1, NM_001282162.1
NP_004921.1, NM_004930.4 [P47756-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000264202; ENSP00000264202; ENSG00000077549 [P47756-2]
ENST00000375142; ENSP00000364284; ENSG00000077549 [P47756-1]
ENST00000674432; ENSP00000501528; ENSG00000077549 [P47756-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		832

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:832

UCSC genome browser

More...UCSCi		uc001bce.5, human [P47756-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U03271 mRNA Translation: AAA87395.1
BT019470 mRNA Translation: AAV38277.1
BT019471 mRNA Translation: AAV38278.1
AL035413 Genomic DNA No translation available.
AL359199 Genomic DNA No translation available.
AL445163 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW94890.1
BC024601 mRNA Translation: AAH24601.1
BC107752 mRNA Translation: AAI07753.1
BC109241 mRNA Translation: AAI09242.1
BC109242 mRNA Translation: AAI09243.1
CCDSiCCDS41277.1 [P47756-2]
CCDS55579.1 [P47756-1]
RefSeqiNP_001193469.1, NM_001206540.2 [P47756-1]
NP_001269091.1, NM_001282162.1
NP_004921.1, NM_004930.4 [P47756-2]

3D structure databases

SMRiP47756
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi107282, 237 interactors
CORUMiP47756
IntActiP47756, 100 interactors
MINTiP47756
STRINGi9606.ENSP00000401010

Chemistry databases

ChEMBLiCHEMBL4295764

PTM databases

CarbonylDBiP47756
iPTMnetiP47756
MetOSiteiP47756
PhosphoSitePlusiP47756
SwissPalmiP47756

Polymorphism and mutation databases

BioMutaiCAPZB
DMDMi13124696

2D gel databases

DOSAC-COBS-2DPAGEiP47756
OGPiP47756
REPRODUCTION-2DPAGEiIPI00026185
SWISS-2DPAGEiP47756

Proteomic databases

EPDiP47756
jPOSTiP47756
MassIVEiP47756
PaxDbiP47756
PeptideAtlasiP47756
PRIDEiP47756
ProteomicsDBi55793 [P47756-1]
55794 [P47756-2]
TopDownProteomicsiP47756-2 [P47756-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		7956, 280 antibodies

The DNASU plasmid repository

More...DNASUi		832

Genome annotation databases

EnsembliENST00000264202; ENSP00000264202; ENSG00000077549 [P47756-2]
ENST00000375142; ENSP00000364284; ENSG00000077549 [P47756-1]
ENST00000674432; ENSP00000501528; ENSG00000077549 [P47756-1]
GeneIDi832
KEGGihsa:832
UCSCiuc001bce.5, human [P47756-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		832
DisGeNETi832
EuPathDBiHostDB:ENSG00000077549.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		CAPZB
HGNCiHGNC:1491, CAPZB
HPAiENSG00000077549, Low tissue specificity
MIMi601572, gene
neXtProtiNX_P47756
OpenTargetsiENSG00000077549
PharmGKBiPA26072

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3174, Eukaryota
GeneTreeiENSGT00390000017957
HOGENOMiCLU_045864_2_0_1
InParanoidiP47756
OMAiGRQAHYK
OrthoDBi1076134at2759
PhylomeDBiP47756
TreeFamiTF105732

Enzyme and pathway databases

PathwayCommonsiP47756
ReactomeiR-HSA-2132295, MHC class II antigen presentation
R-HSA-3371497, HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-6807878, COPI-mediated anterograde transport
R-HSA-6811436, COPI-independent Golgi-to-ER retrograde traffic
R-HSA-983231, Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		832, 693 hits in 857 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CAPZB, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CAPZB

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		832
PharosiP47756, Tbio

Protein Ontology

More...PROi		PR:P47756
RNActiP47756, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000077549, Expressed in smooth muscle tissue and 249 other tissues
ExpressionAtlasiP47756, baseline and differential
GenevisibleiP47756, HS

Family and domain databases

Gene3Di1.20.58.570, 1 hit
2.40.160.80, 1 hit
InterProiView protein in InterPro
IPR037282, CapZ_alpha/beta
IPR042276, CapZ_alpha/beta_2
IPR001698, CAPZB
IPR043175, CAPZB_N
IPR019771, F-actin_capping_bsu_CS
PANTHERiPTHR10619, PTHR10619, 1 hit
PfamiView protein in Pfam
PF01115, F_actin_cap_B, 1 hit
PRINTSiPR00192, FACTINCAPB
SUPFAMiSSF90096, SSF90096, 1 hit
PROSITEiView protein in PROSITE
PS00231, F_ACTIN_CAPPING_BETA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAPZB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P47756
Secondary accession number(s): Q32Q68
, Q5U0L4, Q8TB49, Q9NUC4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: December 2, 2020
This is version 203 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again