Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rap1 GTPase-activating protein 1

Gene

RAP1GAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: UniProtKB
  • GTPase activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB
  • Ras GTPase binding Source: UniProtKB

GO - Biological processi

  • axon guidance Source: Reactome
  • negative regulation of microvillus assembly Source: UniProtKB
  • positive regulation of GTPase activity Source: UniProtKB
  • regulation of GTPase activity Source: UniProtKB
  • regulation of small GTPase mediated signal transduction Source: InterPro
  • signal transduction Source: ProtInc

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-392517 Rap1 signalling
R-HSA-8853659 RET signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P47736

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P47736

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rap1 GTPase-activating protein 1
Short name:
Rap1GAP
Short name:
Rap1GAP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAP1GAP
Synonyms:KIAA0474, RAP1GA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000076864.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9858 RAP1GAP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600278 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P47736

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi100F → E: Impaired dimerization; when associated with E-173. 1 Publication1
Mutagenesisi173L → E: Impaired dimerization; when associated with E-100. 1 Publication1
Mutagenesisi207E → A: Reduces GTPase activation. 1 Publication1
Mutagenesisi267H → A: Abolishes GTPase activation. 1 Publication1
Mutagenesisi286R → A: Reduces GTPase activation. 1 Publication1
Mutagenesisi287H → A: Abolishes GTPase activation. 1 Publication1
Mutagenesisi290N → A or K: Abolishes GTPase activation. 1 Publication1
Mutagenesisi291D → A: Abolishes GTPase activation. 1 Publication1
Mutagenesisi388R → A or P: Reduces GTPase activation. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
5909

Open Targets

More...
OpenTargetsi
ENSG00000076864

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34220

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RAP1GAP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215273877

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000567431 – 663Rap1 GTPase-activating protein 1Add BLAST663

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei441PhosphoserineCombined sources1
Modified residuei484PhosphoserineCombined sources1
Modified residuei499PhosphoserineCombined sources1
Modified residuei515PhosphoserineCombined sources1
Modified residuei541PhosphoserineBy similarity1
Modified residuei542PhosphoserineBy similarity1
Isoform 3 (identifier: P47736-3)
Modified residuei17PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P47736

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P47736

PeptideAtlas

More...
PeptideAtlasi
P47736

PRoteomics IDEntifications database

More...
PRIDEi
P47736

ProteomicsDB human proteome resource

More...
ProteomicsDBi
55789
55790 [P47736-2]
55791 [P47736-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P47736

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P47736

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Significant expression seen in the brain, kidney and pancreas. Abundant in the cerebral cortex and expressed at much lower levels in the spinal cord. Not detected in the lymphoid tissues.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By 12-O-tetradecanoylphorbol-13-acetate (TPA) in promyelocytic HL-60 cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000076864 Expressed in 186 organ(s), highest expression level in putamen

CleanEx database of gene expression profiles

More...
CleanExi
HS_RAP1GAP

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P47736 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P47736 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB003851
HPA001922

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer and heterodimer with RAP1B.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
RAP1BP612243EBI-722307,EBI-358143

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111844, 17 interactors

Protein interaction database and analysis system

More...
IntActi
P47736, 10 interactors

Molecular INTeraction database

More...
MINTi
P47736

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000290101

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1663
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P47736

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P47736

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P47736

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 17GoLocoPROSITE-ProRule annotationAdd BLAST17
Domaini181 – 397Rap-GAPPROSITE-ProRule annotationAdd BLAST217

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3686 Eukaryota
ENOG410XTIX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156138

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231640

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG059804

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P47736

KEGG Orthology (KO)

More...
KOi
K17700

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P47736

TreeFam database of animal gene trees

More...
TreeFami
TF318626

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.11210, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003109 GoLoco_motif
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02188 GoLoco, 1 hit
PF02145 Rap_GAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00390 GoLoco, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111347 SSF111347, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50877 GOLOCO, 1 hit
PS50085 RAPGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P47736-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIEKMQGSRM DEQRCSFPPP LKTEEDYIPY PSVHEVLGRE GPFPLILLPQ
60 70 80 90 100
FGGYWIEGTN HEITSIPETE PLQSPTTKVK LECNPTARIY RKHFLGKEHF
110 120 130 140 150
NYYSLDAALG HLVFSLKYDV IGDQEHLRLL LRTKCRTYHD VIPISCLTEF
160 170 180 190 200
PNVVQMAKLV CEDVNVDRFY PVLYPKASRL IVTFDEHVIS NNFKFGVIYQ
210 220 230 240 250
KLGQTSEEEL FSTNEESPAF VEFLEFLGQK VKLQDFKGFR GGLDVTHGQT
260 270 280 290 300
GTESVYCNFR NKEIMFHVST KLPYTEGDAQ QLQRKRHIGN DIVAVVFQDE
310 320 330 340 350
NTPFVPDMIA SNFLHAYVVV QAEGGGPDGP LYKVSVTARD DVPFFGPPLP
360 370 380 390 400
DPAVFRKGPE FQEFLLTKLI NAEYACYKAE KFAKLEERTR AALLETLYEE
410 420 430 440 450
LHIHSQSMMG LGGDEDKMEN GSGGGGFFES FKRVIRSRSQ SMDAMGLSNK
460 470 480 490 500
KPNTVSTSHS GSFAPNNPDL AKAAGISLIV PGKSPTRKKS GPFGSRRSSA
510 520 530 540 550
IGIENIQEVQ EKRESPPAGQ KTPDSGHVSQ EPKSENSSTQ SSPEMPTTKN
560 570 580 590 600
RAETAAQRAE ALKDFSRSSS SASSFASVVE ETEGVDGEDT GLESVSSSGT
610 620 630 640 650
PHKRDSFIYS TWLEDSVSTT SGGSSPGPSR SPHPDAGKLG DPACPEIKIQ
660
LEASEQHMPQ LGC
Length:663
Mass (Da):73,361
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i89B307CC67F975DD
GO
Isoform 2 (identifier: P47736-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-476: I → ISLLIPGKSASRFGRRGSAIGIGTVEE
     626-633: Missing.

Show »
Length:681
Mass (Da):75,187
Checksum:i7B2B680087CFCCB4
GO
Isoform 3 (identifier: P47736-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAQLRPAVPPGRPRRGSLPAGASWQNTDLFEM
     280-280: Missing.

Show »
Length:693
Mass (Da):76,592
Checksum:iBEB784BF1F8E67F3
GO
Isoform 4 (identifier: P47736-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGRKRSFTFGAYGGVDKSFTSRRSVWRSDGQNQHFPQALDLSRVNLVPSYTPSLYPKNTDLFEM

Note: No experimental confirmation available.
Show »
Length:727
Mass (Da):80,645
Checksum:iB106FC67B06E1615
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X6R8W7X6R8W7_HUMAN
Rap1 GTPase-activating protein 1
RAP1GAP
748Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KPC5J3KPC5_HUMAN
RAP1, GTPase activating protein 1, ...
RAP1GAP RAP1GA1, hCG_37586
694Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z357F2Z357_HUMAN
Rap1 GTPase-activating protein 1
RAP1GAP
602Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MQY8A0A0A0MQY8_HUMAN
Rap1 GTPase-activating protein 1
RAP1GAP
692Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T3T1Q5T3T1_HUMAN
Rap1 GTPase-activating protein 1
RAP1GAP
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T3T0Q5T3T0_HUMAN
Rap1 GTPase-activating protein 1
RAP1GAP
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH54490 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA32319 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti304F → L in AAH54490 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047792107A → T1 PublicationCorresponds to variant dbSNP:rs2275363Ensembl.1
Natural variantiVAR_035547257C → R in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_035548609Y → C in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs147394161Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0402601M → MAQLRPAVPPGRPRRGSLPA GASWQNTDLFEM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0470251M → MSGRKRSFTFGAYGGVDKSF TSRRSVWRSDGQNQHFPQAL DLSRVNLVPSYTPSLYPKNT DLFEM in isoform 4. Curated1
Alternative sequenceiVSP_040261280Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_035256476I → ISLLIPGKSASRFGRRGSAI GIGTVEE in isoform 2. 1 Publication1
Alternative sequenceiVSP_035257626 – 633Missing in isoform 2. 1 Publication8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M64788 mRNA Translation: AAA60252.1
AB007943 mRNA Translation: BAA32319.3 Different initiation.
AL359815 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW94980.1
CH471134 Genomic DNA Translation: EAW94981.1
AB003930 mRNA Translation: BAA83674.1
BC054490 mRNA Translation: AAH54490.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS218.1 [P47736-1]
CCDS53276.1 [P47736-2]
CCDS53277.1 [P47736-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A39897
B39897

NCBI Reference Sequences

More...
RefSeqi
NP_001139129.1, NM_001145657.1 [P47736-2]
NP_001139130.1, NM_001145658.1 [P47736-4]
NP_002876.2, NM_002885.2 [P47736-1]
XP_005246012.2, XM_005245955.3 [P47736-2]
XP_016857459.1, XM_017001970.1 [P47736-2]
XP_016857462.1, XM_017001973.1 [P47736-1]
XP_016857473.1, XM_017001984.1 [P47736-2]
XP_016857475.1, XM_017001986.1
XP_016857476.1, XM_017001987.1 [P47736-1]
XP_016857477.1, XM_017001988.1 [P47736-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.148178

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374765; ENSP00000363897; ENSG00000076864 [P47736-1]
ENST00000495204; ENSP00000434033; ENSG00000076864 [P47736-4]
ENST00000542643; ENSP00000441661; ENSG00000076864 [P47736-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5909

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5909

UCSC genome browser

More...
UCSCi
uc001bew.4 human [P47736-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64788 mRNA Translation: AAA60252.1
AB007943 mRNA Translation: BAA32319.3 Different initiation.
AL359815 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW94980.1
CH471134 Genomic DNA Translation: EAW94981.1
AB003930 mRNA Translation: BAA83674.1
BC054490 mRNA Translation: AAH54490.1 Different initiation.
CCDSiCCDS218.1 [P47736-1]
CCDS53276.1 [P47736-2]
CCDS53277.1 [P47736-4]
PIRiA39897
B39897
RefSeqiNP_001139129.1, NM_001145657.1 [P47736-2]
NP_001139130.1, NM_001145658.1 [P47736-4]
NP_002876.2, NM_002885.2 [P47736-1]
XP_005246012.2, XM_005245955.3 [P47736-2]
XP_016857459.1, XM_017001970.1 [P47736-2]
XP_016857462.1, XM_017001973.1 [P47736-1]
XP_016857473.1, XM_017001984.1 [P47736-2]
XP_016857475.1, XM_017001986.1
XP_016857476.1, XM_017001987.1 [P47736-1]
XP_016857477.1, XM_017001988.1 [P47736-1]
UniGeneiHs.148178

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1SRQX-ray2.90A/B/C/D75-415[»]
3BRWX-ray3.40A/B/C75-415[»]
ProteinModelPortaliP47736
SMRiP47736
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111844, 17 interactors
IntActiP47736, 10 interactors
MINTiP47736
STRINGi9606.ENSP00000290101

PTM databases

iPTMnetiP47736
PhosphoSitePlusiP47736

Polymorphism and mutation databases

BioMutaiRAP1GAP
DMDMi215273877

Proteomic databases

MaxQBiP47736
PaxDbiP47736
PeptideAtlasiP47736
PRIDEiP47736
ProteomicsDBi55789
55790 [P47736-2]
55791 [P47736-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5909
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374765; ENSP00000363897; ENSG00000076864 [P47736-1]
ENST00000495204; ENSP00000434033; ENSG00000076864 [P47736-4]
ENST00000542643; ENSP00000441661; ENSG00000076864 [P47736-2]
GeneIDi5909
KEGGihsa:5909
UCSCiuc001bew.4 human [P47736-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5909
DisGeNETi5909
EuPathDBiHostDB:ENSG00000076864.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RAP1GAP
HGNCiHGNC:9858 RAP1GAP
HPAiCAB003851
HPA001922
MIMi600278 gene
neXtProtiNX_P47736
OpenTargetsiENSG00000076864
PharmGKBiPA34220

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3686 Eukaryota
ENOG410XTIX LUCA
GeneTreeiENSGT00940000156138
HOGENOMiHOG000231640
HOVERGENiHBG059804
InParanoidiP47736
KOiK17700
PhylomeDBiP47736
TreeFamiTF318626

Enzyme and pathway databases

ReactomeiR-HSA-392517 Rap1 signalling
R-HSA-8853659 RET signaling
SignaLinkiP47736
SIGNORiP47736

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RAP1GAP human
EvolutionaryTraceiP47736

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RAP1GAP

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5909

Protein Ontology

More...
PROi
PR:P47736

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000076864 Expressed in 186 organ(s), highest expression level in putamen
CleanExiHS_RAP1GAP
ExpressionAtlasiP47736 baseline and differential
GenevisibleiP47736 HS

Family and domain databases

Gene3Di3.40.50.11210, 1 hit
InterProiView protein in InterPro
IPR003109 GoLoco_motif
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
PfamiView protein in Pfam
PF02188 GoLoco, 1 hit
PF02145 Rap_GAP, 1 hit
SMARTiView protein in SMART
SM00390 GoLoco, 1 hit
SUPFAMiSSF111347 SSF111347, 1 hit
PROSITEiView protein in PROSITE
PS50877 GOLOCO, 1 hit
PS50085 RAPGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRPGP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P47736
Secondary accession number(s): J3QSS6
, O75062, Q5T3S9, Q5T3T4, Q7Z5S8, Q9UQ51
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: November 25, 2008
Last modified: December 5, 2018
This is version 161 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again