Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P46379 (BAG6_HUMAN)

Entry version 196 (12 Aug 2020)
Sequence version 2 (27 Sep 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Large proline-rich protein BAG6

Gene

BAG6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ATP-independent molecular chaperone preventing the aggregation of misfolded and hydrophobic patches-containing proteins (PubMed:21636303). Functions as part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, which maintains these client proteins in a soluble state and participates in their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation (PubMed:20516149, PubMed:21636303, PubMed:21743475, PubMed:28104892). The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum (PubMed:20516149, PubMed:20676083, PubMed:28104892, PubMed:25535373). Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated by RNF126, an E3 ubiquitin-protein ligase associated with BAG6 and are sorted to the proteasome (PubMed:24981174, PubMed:28104892, PubMed:27193484). SGTA which prevents the recruitment of RNF126 to BAG6 may negatively regulate the ubiquitination and the proteasomal degradation of client proteins (PubMed:23129660, PubMed:25179605, PubMed:27193484). Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum (PubMed:21743475). The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome (PubMed:21636303). BAG6 is also required for selective ubiquitin-mediated degradation of defective nascent chain polypeptides by the proteasome. In this context, it may participate in the production of antigenic peptides and play a role in antigen presentation in immune response (By similarity). BAG6 is also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation. BAG6 may ensure the proper degradation of these proteins and thereby protects the endoplasmic reticulum from protein overload upon stress (PubMed:26565908). By inhibiting the polyubiquitination and subsequent proteasomal degradation of HSPA2 it may also play a role in the assembly of the synaptonemal complex during spermatogenesis (By similarity). Also positively regulates apoptosis by interacting with and stabilizing the proapoptotic factor AIFM1 (By similarity). By controlling the steady-state expression of the IGF1R receptor, indirectly regulates the insulin-like growth factor receptor signaling pathway (PubMed:26692333).By similarity11 Publications
Involved in DNA damage-induced apoptosis: following DNA damage, accumulates in the nucleus and forms a complex with p300/EP300, enhancing p300/EP300-mediated p53/TP53 acetylation leading to increase p53/TP53 transcriptional activity (PubMed:17403783). When nuclear, may also act as a component of some chromatin regulator complex that regulates histone 3 'Lys-4' dimethylation (H3K4me2) (PubMed:18765639).2 Publications
Released extracellularly via exosomes, it is a ligand of the natural killer/NK cells receptor NCR3 and stimulates NK cells cytotoxicity. It may thereby trigger NK cells cytotoxicity against neighboring tumor cells and immature myeloid dendritic cells (DC).2 Publications
Mediates ricin-induced apoptosis.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone, Chromatin regulator
Biological processApoptosis, Differentiation, Immunity, Spermatogenesis, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P46379

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-9609523, Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Large proline-rich protein BAG6Curated
Alternative name(s):
BAG family molecular chaperone regulator 6
BCL2-associated athanogene 6Imported
Short name:
BAG-6
HLA-B-associated transcript 31 Publication
Protein G3
Protein Scythe1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BAG6Imported
Synonyms:BAT31 Publication, G3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000204463.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:13919, BAG6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		142590, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P46379

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1001D → A: Abolishes cleavage by the caspase CASP3. 1 Publication1
Mutagenesisi1010W → A: Decreases interaction with GET4. Localizes in the nucleus and cytoplasm. Decreases interaction with GET4, localizes in the nucleus and increases GET4 ubiquitination; when associated with A-1042. 1 Publication1
Mutagenesisi1018W → A: Decreases interaction with GET4. Localizes in the nucleus. Decreases interaction with GET4, localizes in the nucleus and increases GET4 ubiquitination; when associated with A-1042. 1 Publication1
Mutagenesisi1030 – 1031RK → SL: No effect on interaction with GET4 and KPNA2. 1 Publication2
Mutagenesisi1042Y → A: Decreases interaction with GET4. Localizes in the nucleus. Decreases interaction with GET4, localizes in the nucleus and increases GET4 ubiquitination; when associated with A-1010 or A-1018. 1 Publication1
Mutagenesisi1049 – 1050KR → SL: No effect on interaction with GET4. Inhibits interaction with KPNA2. 1 Publication2
Mutagenesisi1067V → R: No effect on interaction with UBL4A. No effect on interaction with UBL4A; when associated with A-1078. Abolishes on interaction with UBL4A; when associated with R-1085. 1 Publication1
Mutagenesisi1078P → A: No effect on interaction with UBL4A. No effect on interaction with UBL4A; when associated with R-1067 or R-1085. 1 Publication1
Mutagenesisi1085L → R: No effect on interaction with UBL4A. No effect on interaction with UBL4A; when associated with R-1078. Abolishes on interaction with UBL4A; when associated with R-1067. 1 Publication1
Mutagenesisi1088D → H: No effect on interaction with UBL4A. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		7917

Open Targets

More...OpenTargetsi		ENSG00000204463

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25264

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P46379, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BAG6

Domain mapping of disease mutations (DMDM)

More...DMDMi		76800648

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001148971 – 1132Large proline-rich protein BAG6Add BLAST1132

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei96PhosphoserineCombined sources1
Modified residuei113PhosphoserineCombined sources1
Modified residuei117PhosphothreonineCombined sources1
Modified residuei350PhosphothreonineCombined sources1
Modified residuei964PhosphoserineCombined sources1
Modified residuei973PhosphoserineCombined sources1
Modified residuei1053PhosphothreonineCombined sources1
Modified residuei1081PhosphoserineCombined sources1
Modified residuei1117PhosphoserineCombined sources1
Isoform 4 (identifier: P46379-4)
Modified residuei832PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ricin can induce a cleavage by the caspase CASP3. The released C-terminal peptide induces apoptosis.1 Publication
(Microbial infection) In case of infection by L.pneumophila, ubiquitinated by the SCF(LegU1) complex.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei1001 – 1002Cleavage; by CASP31 Publication2

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P46379

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P46379

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P46379

MaxQB - The MaxQuant DataBase

More...MaxQBi		P46379

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P46379

PeptideAtlas

More...PeptideAtlasi		P46379

PRoteomics IDEntifications database

More...PRIDEi		P46379

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		17045
29168
55736 [P46379-1]
55737 [P46379-2]
55738 [P46379-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P46379, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P46379

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P46379

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P46379

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P46379

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed by immature dendritic cells (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000204463, Expressed in testis and 242 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P46379, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P46379, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000204463, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the BAG6/BAT3 complex, also named BAT3 complex, at least composed of BAG6, UBL4A and GET4/TRC35 (PubMed:20676083).

Interacts with GET4; the interaction is direct and localizes BAG6 in the cytosol (PubMed:21636303, PubMed:29042515).

Interacts with UBL4A; the interaction is direct and required for UBL4A protein stability (PubMed:25713138).

Interacts with AIFM1 (By similarity).

Interacts with HSPA2 (By similarity).

Interacts with CTCFL (PubMed:18765639).

Interacts with p300/EP300 (PubMed:17403783).

Interacts (via ubiquitin-like domain) with RNF126; required for BAG6-dependent ubiquitination of proteins mislocalized to the cytosol (PubMed:24981174, PubMed:27193484).

Interacts (via ubiquitin-like domain) with SGTA; SGTA competes with RNF126 by binding the same region of BAG6, thereby promoting deubiquitination of BAG6-target proteins and rescuing them from degradation (PubMed:23129660, PubMed:24424410, PubMed:25179605, PubMed:27193484).

Interacts with ricin A chain (PubMed:14960581).

Interacts with VCP and AMFR; both form the VCP/p97-AMFR/gp78 complex (PubMed:21636303).

Interacts with SYVN1 (PubMed:21636303).

Interacts with USP13; the interaction is direct and may mediate UBL4A deubiquitination (PubMed:24424410).

Interacts with ZFAND2B (PubMed:24160817, PubMed:26337389).

Interacts with KPNA2 (PubMed:29042515).

Interacts with UBQLN4 (PubMed:27113755).

By similarity15 Publications

(Microbial infection) Interacts with L. pneumophila Lpg2160 and LegU1 proteins.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113647, 351 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-132, BAT3 complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P46379

Database of interacting proteins

More...DIPi		DIP-31191N

Protein interaction database and analysis system

More...IntActi		P46379, 282 interactors

Molecular INTeraction database

More...MINTi		P46379

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000365131

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P46379, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11132
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P46379

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P46379

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini17 – 92Ubiquitin-likePROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati242 – 27011 PublicationAdd BLAST29
Repeati415 – 44321 PublicationAdd BLAST29
Repeati574 – 60231 PublicationAdd BLAST29
Repeati608 – 63641 PublicationAdd BLAST29

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni242 – 6364 X 29 AA approximate repeats1 PublicationAdd BLAST395
Regioni1010 – 1040Required for interaction with GET42 PublicationsAdd BLAST31
Regioni1022 – 1132Sufficient for the delivery of client proteins to the endoplasmic reticulum1 PublicationAdd BLAST111
Regioni1058 – 1115BAG-similar domain, required and sufficient for interaction with UBL4A2 PublicationsAdd BLAST58

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1012 – 1054Nuclear localization site2 PublicationsAdd BLAST43

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi195 – 273Pro-richPROSITE-ProRule annotationAdd BLAST79
Compositional biasi394 – 681Pro-richPROSITE-ProRule annotationAdd BLAST288

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The ubiquitin-like domain mediates interaction with the E3 ubiquitin-protein ligase RNF126 which is responsible for the BAG6-dependent ubiquitination of client proteins (PubMed:21743475, PubMed:24981174, PubMed:28104892, PubMed:27193484). SGTA also binds this domain and competes with RNF126 to antagonize client protein ubiquitination and degradation (PubMed:28104892). The ubiquitin-like domain also mediates the interaction with USP13 (PubMed:24424410).5 Publications

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4248, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000016199

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012159_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P46379

KEGG Orthology (KO)

More...KOi		K23390

Identification of Orthologs from Complete Genome Data

More...OMAi		AQMHGNA

Database of Orthologous Groups

More...OrthoDBi		1233552at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P46379

TreeFam database of animal gene trees

More...TreeFami		TF328437

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR021925, BAG6
IPR000626, Ubiquitin-like_dom
IPR029071, Ubiquitin-like_domsf
IPR019954, Ubiquitin_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12057, BAG6, 1 hit
PF00240, ubiquitin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00213, UBQ, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54236, SSF54236, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00299, UBIQUITIN_1, 1 hit
PS50053, UBIQUITIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 23 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P46379-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPNDSTSTA VEEPDSLEVL VKTLDSQTRT FIVGAQMNVK EFKEHIAASV 
        60         70         80         90        100
SIPSEKQRLI YQGRVLQDDK KLQEYNVGGK VIHLVERAPP QTHLPSGASS 
       110        120        130        140        150
GTGSASATHG GGSPPGTRGP GASVHDRNAN SYVMVGTFNL PSDGSAVDVH 
       160        170        180        190        200
INMEQAPIQS EPRVRLVMAQ HMIRDIQTLL SRMETLPYLQ CRGGPQPQHS 
       210        220        230        240        250
QPPPQPPAVT PEPVALSSQT SEPVESEAPP REPMEAEEVE ERAPAQNPEL 
       260        270        280        290        300
TPGPAPAGPT PAPETNAPNH PSPAEYVEVL QELQRLESRL QPFLQRYYEV 
       310        320        330        340        350
LGAAATTDYN NNHEGREEDQ RLINLVGESL RLLGNTFVAL SDLRCNLACT 
       360        370        380        390        400
PPRHLHVVRP MSHYTTPMVL QQAAIPIQIN VGTTVTMTGN GTRPPPTPNA 
       410        420        430        440        450
EAPPPGPGQA SSVAPSSTNV ESSAEGAPPP GPAPPPATSH PRVIRISHQS 
       460        470        480        490        500
VEPVVMMHMN IQDSGTQPGG VPSAPTGPLG PPGHGQTLGQ QVPGFPTAPT 
       510        520        530        540        550
RVVIARPTPP QARPSHPGGP PVSGTLQGAG LGTNASLAQM VSGLVGQLLM 
       560        570        580        590        600
QPVLVAQGTP GMAPPPAPAT ASASAGTTNT ATTAGPAPGG PAQPPPTPQP 
       610        620        630        640        650
SMADLQFSQL LGNLLGPAGP GAGGSGVASP TITVAMPGVP AFLQGMTDFL 
       660        670        680        690        700
QATQTAPPPP PPPPPPPPAP EQQTMPPPGS PSGGAGSPGG LGLESLSPEF 
       710        720        730        740        750
FTSVVQGVLS SLLGSLGARA GSSESIAAFI QRLSGSSNIF EPGADGALGF 
       760        770        780        790        800
FGALLSLLCQ NFSMVDVVML LHGHFQPLQR LQPQLRSFFH QHYLGGQEPT 
       810        820        830        840        850
PSNIRMATHT LITGLEEYVR ESFSLVQVQP GVDIIRTNLE FLQEQFNSIA 
       860        870        880        890        900
AHVLHCTDSG FGARLLELCN QGLFECLALN LHCLGGQQME LAAVINGRIR 
       910        920        930        940        950
RMSRGVNPSL VSWLTTMMGL RLQVVLEHMP VGPDAILRYV RRVGDPPQPL 
       960        970        980        990       1000
PEEPMEVQGA ERASPEPQRE NASPAPGTTA EEAMSRGPPP APEGGSRDEQ 
      1010       1020       1030       1040       1050
DGASAETEPW AAAVPPEWVP IIQQDIQSQR KVKPQPPLSD AYLSGMPAKR 
      1060       1070       1080       1090       1100
RKTMQGEGPQ LLLSEAVSRA AKAAGARPLT SPESLSRDLE APEVQESYRQ 
      1110       1120       1130 
QLRSDIQKRL QEDPNYSPQR FPNAQRAFAD DP
Length:1,132
Mass (Da):119,409
Last modified:September 27, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i625B5F86321367ED
GO
Isoform 2 (identifier: P46379-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.

Show »
Length:1,126
Mass (Da):118,693
Checksum:i8A67290BC8176ABA
GO
Isoform 3 (identifier: P46379-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.
     489-489: G → GSTLIQLPSLPPEFMHAVAHQITHQAMVAAVASAAAG

Show »
Length:1,162
Mass (Da):122,342
Checksum:iFE67886ACE6F6432
GO
Isoform 4 (identifier: P46379-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.
     527-527: Missing.
     561-685: Missing.
     969-1016: Missing.
     1053-1101: Missing.

Show »
Length:903
Mass (Da):96,800
Checksum:i71B4D33EB924A0EA
GO
Isoform 5 (identifier: P46379-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.
     1053-1101: Missing.

Show »
Length:1,077
Mass (Da):113,456
Checksum:iCB94D1C58A1E3D21
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 23 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A024RCR6A0A024RCR6_HUMAN
BCL2-associated athanogene 6
BAG6 BAT3, hCG_2005629
1,126Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6S6P2F6S6P2_HUMAN
BCL2-associated athanogene 6
BAG6
515Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6REW1X6REW1_HUMAN
BCL2-associated athanogene 6
BAG6
742Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JK23A0A0G2JK23_HUMAN
BCL2-associated athanogene 6
BAG6
1,132Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JL47A0A0G2JL47_HUMAN
BCL2-associated athanogene 6
BAG6
1,077Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JJM1A0A0G2JJM1_HUMAN
BCL2-associated athanogene 6
BAG6
742Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4L1H0Y4L1_HUMAN
Large proline-rich protein BAG6
BAG6
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7K4H0Y7K4_HUMAN
Large proline-rich protein BAG6
BAG6
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6TC96F6TC96_HUMAN
Large proline-rich protein BAG6
BAG6
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6VEM6F6VEM6_HUMAN
Large proline-rich protein BAG6
BAG6
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD18085 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAB63390 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti43K → R in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti47A → R in AAA35587 (PubMed:2156268).Curated1
Sequence conflicti150H → D in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti511Q → R in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti561G → D in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti617P → L in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti679G → R in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti839L → R in BAG63924 (PubMed:14702039).Curated1
Sequence conflicti842L → P in BAG63924 (PubMed:14702039).Curated1
Sequence conflicti853V → M in CAI46045 (PubMed:17974005).Curated1
Sequence conflicti854L → Q in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti927E → D in BAG65616 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023531625S → P5 PublicationsCorresponds to variant dbSNP:rs1052486Ensembl.1
Natural variantiVAR_037150728A → V. Corresponds to variant dbSNP:rs11548856Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015695185 – 190Missing in isoform 2, isoform 3, isoform 4 and isoform 5. 3 Publications6
Alternative sequenceiVSP_030519489G → GSTLIQLPSLPPEFMHAVAH QITHQAMVAAVASAAAG in isoform 3. Curated1
Alternative sequenceiVSP_045910527Missing in isoform 4. 1 Publication1
Alternative sequenceiVSP_045911561 – 685Missing in isoform 4. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_045912969 – 1016Missing in isoform 4. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_0459131053 – 1101Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M33519 mRNA Translation: AAA35587.1
M33521, M33520 Genomic DNA Translation: AAA35588.1
BX647244 mRNA Translation: CAI46045.1
AK302695 mRNA Translation: BAG63924.1
AK304879 mRNA Translation: BAG65616.1
AF129756 Genomic DNA Translation: AAD18085.1 Different initiation.
BA000025 Genomic DNA Translation: BAB63390.1 Different initiation.
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL670886 Genomic DNA No translation available.
AL805934 Genomic DNA No translation available.
BX511262 Genomic DNA No translation available.
CR354443 Genomic DNA No translation available.
CR753842 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759761 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03455.1
BC003133 mRNA Translation: AAH03133.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4709.1 [P46379-2]
CCDS56414.1 [P46379-4]
CCDS56415.1 [P46379-5]

Protein sequence database of the Protein Information Resource

More...PIRi		A35098

NCBI Reference Sequences

More...RefSeqi		NP_001092004.1, NM_001098534.1 [P46379-2]
NP_001186626.1, NM_001199697.1 [P46379-4]
NP_001186627.1, NM_001199698.1 [P46379-5]
NP_004630.3, NM_004639.3 [P46379-1]
NP_542433.1, NM_080702.2 [P46379-2]
NP_542434.1, NM_080703.2 [P46379-2]
XP_016866776.1, XM_017011287.1 [P46379-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000211379; ENSP00000211379; ENSG00000204463 [P46379-2]
ENST00000361076; ENSP00000354368; ENSG00000096155 [P46379-1]
ENST00000362049; ENSP00000354875; ENSG00000204463 [P46379-5]
ENST00000375964; ENSP00000365131; ENSG00000204463 [P46379-1]
ENST00000375976; ENSP00000365143; ENSG00000204463 [P46379-2]
ENST00000383446; ENSP00000372938; ENSG00000096155 [P46379-2]
ENST00000383448; ENSP00000372940; ENSG00000096155 [P46379-2]
ENST00000417144; ENSP00000412110; ENSG00000229524 [P46379-2]
ENST00000419847; ENSP00000389121; ENSG00000233348 [P46379-2]
ENST00000439687; ENSP00000402856; ENSG00000204463 [P46379-4]
ENST00000442479; ENSP00000413698; ENSG00000229524 [P46379-2]
ENST00000443182; ENSP00000410156; ENSG00000233348 [P46379-2]
ENST00000449450; ENSP00000397894; ENSG00000229524 [P46379-1]
ENST00000451932; ENSP00000390966; ENSG00000233348 [P46379-1]
ENST00000551350; ENSP00000447546; ENSG00000229524 [P46379-5]
ENST00000552116; ENSP00000447946; ENSG00000233348 [P46379-5]
ENST00000552605; ENSP00000446525; ENSG00000096155 [P46379-5]
ENST00000613474; ENSP00000478966; ENSG00000227761 [P46379-4]
ENST00000615143; ENSP00000482413; ENSG00000229524 [P46379-4]
ENST00000615224; ENSP00000477951; ENSG00000228760 [P46379-4]
ENST00000615725; ENSP00000479238; ENSG00000233348 [P46379-4]
ENST00000617635; ENSP00000484238; ENSG00000096155 [P46379-4]
ENST00000621056; ENSP00000477867; ENSG00000234651 [P46379-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7917

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7917

UCSC genome browser

More...UCSCi		uc003nvf.4, human [P46379-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M33519 mRNA Translation: AAA35587.1
M33521, M33520 Genomic DNA Translation: AAA35588.1
BX647244 mRNA Translation: CAI46045.1
AK302695 mRNA Translation: BAG63924.1
AK304879 mRNA Translation: BAG65616.1
AF129756 Genomic DNA Translation: AAD18085.1 Different initiation.
BA000025 Genomic DNA Translation: BAB63390.1 Different initiation.
AL662801 Genomic DNA No translation available.
AL662847 Genomic DNA No translation available.
AL670886 Genomic DNA No translation available.
AL805934 Genomic DNA No translation available.
BX511262 Genomic DNA No translation available.
CR354443 Genomic DNA No translation available.
CR753842 Genomic DNA No translation available.
CR753892 Genomic DNA No translation available.
CR759761 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03455.1
BC003133 mRNA Translation: AAH03133.1
CCDSiCCDS4709.1 [P46379-2]
CCDS56414.1 [P46379-4]
CCDS56415.1 [P46379-5]
PIRiA35098
RefSeqiNP_001092004.1, NM_001098534.1 [P46379-2]
NP_001186626.1, NM_001199697.1 [P46379-4]
NP_001186627.1, NM_001199698.1 [P46379-5]
NP_004630.3, NM_004639.3 [P46379-1]
NP_542433.1, NM_080702.2 [P46379-2]
NP_542434.1, NM_080703.2 [P46379-2]
XP_016866776.1, XM_017011287.1 [P46379-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WX9NMR-A17-89[»]
2N9PNMR-C17-101[»]
4DWFX-ray1.80A/B13-101[»]
4EEWX-ray1.30A/B1-87[»]
4WWRX-ray2.00A/C/E/G1060-1111[»]
4X86X-ray1.85B1048-1123[»]
6AU8X-ray1.80C1008-1050[»]
SMRiP46379
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113647, 351 interactors
ComplexPortaliCPX-132, BAT3 complex
CORUMiP46379
DIPiDIP-31191N
IntActiP46379, 282 interactors
MINTiP46379
STRINGi9606.ENSP00000365131

PTM databases

GlyGeniP46379, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP46379
MetOSiteiP46379
PhosphoSitePlusiP46379
SwissPalmiP46379

Polymorphism and mutation databases

BioMutaiBAG6
DMDMi76800648

Proteomic databases

EPDiP46379
jPOSTiP46379
MassIVEiP46379
MaxQBiP46379
PaxDbiP46379
PeptideAtlasiP46379
PRIDEiP46379
ProteomicsDBi17045
29168
55736 [P46379-1]
55737 [P46379-2]
55738 [P46379-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		27346, 283 antibodies

Genome annotation databases

EnsembliENST00000211379; ENSP00000211379; ENSG00000204463 [P46379-2]
ENST00000361076; ENSP00000354368; ENSG00000096155 [P46379-1]
ENST00000362049; ENSP00000354875; ENSG00000204463 [P46379-5]
ENST00000375964; ENSP00000365131; ENSG00000204463 [P46379-1]
ENST00000375976; ENSP00000365143; ENSG00000204463 [P46379-2]
ENST00000383446; ENSP00000372938; ENSG00000096155 [P46379-2]
ENST00000383448; ENSP00000372940; ENSG00000096155 [P46379-2]
ENST00000417144; ENSP00000412110; ENSG00000229524 [P46379-2]
ENST00000419847; ENSP00000389121; ENSG00000233348 [P46379-2]
ENST00000439687; ENSP00000402856; ENSG00000204463 [P46379-4]
ENST00000442479; ENSP00000413698; ENSG00000229524 [P46379-2]
ENST00000443182; ENSP00000410156; ENSG00000233348 [P46379-2]
ENST00000449450; ENSP00000397894; ENSG00000229524 [P46379-1]
ENST00000451932; ENSP00000390966; ENSG00000233348 [P46379-1]
ENST00000551350; ENSP00000447546; ENSG00000229524 [P46379-5]
ENST00000552116; ENSP00000447946; ENSG00000233348 [P46379-5]
ENST00000552605; ENSP00000446525; ENSG00000096155 [P46379-5]
ENST00000613474; ENSP00000478966; ENSG00000227761 [P46379-4]
ENST00000615143; ENSP00000482413; ENSG00000229524 [P46379-4]
ENST00000615224; ENSP00000477951; ENSG00000228760 [P46379-4]
ENST00000615725; ENSP00000479238; ENSG00000233348 [P46379-4]
ENST00000617635; ENSP00000484238; ENSG00000096155 [P46379-4]
ENST00000621056; ENSP00000477867; ENSG00000234651 [P46379-4]
GeneIDi7917
KEGGihsa:7917
UCSCiuc003nvf.4, human [P46379-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7917
DisGeNETi7917
EuPathDBiHostDB:ENSG00000204463.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		BAG6
HGNCiHGNC:13919, BAG6
HPAiENSG00000204463, Low tissue specificity
MIMi142590, gene
neXtProtiNX_P46379
OpenTargetsiENSG00000204463
PharmGKBiPA25264

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4248, Eukaryota
GeneTreeiENSGT00390000016199
HOGENOMiCLU_012159_0_0_1
InParanoidiP46379
KOiK23390
OMAiAQMHGNA
OrthoDBi1233552at2759
PhylomeDBiP46379
TreeFamiTF328437

Enzyme and pathway databases

PathwayCommonsiP46379
ReactomeiR-HSA-9609523, Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7917, 27 hits in 882 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BAG6, human
EvolutionaryTraceiP46379

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		HLA-B_associated_transcript_3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7917
PharosiP46379, Tbio

Protein Ontology

More...PROi		PR:P46379
RNActiP46379, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000204463, Expressed in testis and 242 other tissues
ExpressionAtlasiP46379, baseline and differential
GenevisibleiP46379, HS

Family and domain databases

InterProiView protein in InterPro
IPR021925, BAG6
IPR000626, Ubiquitin-like_dom
IPR029071, Ubiquitin-like_domsf
IPR019954, Ubiquitin_CS
PfamiView protein in Pfam
PF12057, BAG6, 1 hit
PF00240, ubiquitin, 1 hit
SMARTiView protein in SMART
SM00213, UBQ, 1 hit
SUPFAMiSSF54236, SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00299, UBIQUITIN_1, 1 hit
PS50053, UBIQUITIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBAG6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P46379
Secondary accession number(s): A2ADJ7
, A3KQ42, A3KQ44, A6NGY6, A6PWF7, B0UX84, B4DZ12, B4E3V4, E7EMZ4, F8VXY4, O95874, Q5HYL9, Q5SQ35, Q5SQ36, Q5SQ37, Q5SQ41, Q5SRP8, Q5SRP9, Q5STC1, Q5STX1, Q5STX3, Q96SA6, Q9BCN4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: September 27, 2005
Last modified: August 12, 2020
This is version 196 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again