Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 179 (26 Feb 2020)
Sequence version 2 (01 Nov 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Moesin/ezrin/radixin homolog 1

Gene

Moe

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in connections of major cytoskeletal structures to the plasma membrane (PubMed:8666669). Together with wgn, involved in control of axon targeting of R8 and R2-R5 photoreceptors, independent of egr (PubMed:23544124). In the nucleus, recruited to sites of active transcription by RNA polymerase II where it has a role in nuclear mRNA export together with the mRNA export factor PCID2 and other messenger ribonucleoprotein (mRNP) particles (PubMed:28554770).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
Biological processNeurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-373752 Netrin-1 signaling

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.A.25.1.4 the ezrin/radixin/moesin (ezrin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Moesin/ezrin/radixin homolog 1
Short name:
Ezrin-moesin-radixin 1
Alternative name(s):
Moesin
Short name:
dMoesin
Protein D17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Moe
Synonyms:EMR1
ORF Names:CG10701
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0011661 Moe

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Chromosome, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002194251 – 578Moesin/ezrin/radixin homolog 1Add BLAST578

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
P46150

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P46150

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in apical and basolateral ends of follicular epithelium during oogenesis (PubMed:8666669). In embryonic CNS, expression is seen in the neuropil, developing brain and neuronal cell bodies (PubMed:8666669). In embryonic PNS, expression is seen at the cell membrane (PubMed:8666669). In third instar larvae, eye imaginal disk expression is seen at the membranes of developing photoreceptors posterior to the morphogenetic furrow (PubMed:8666669). In pupal eyes, expression is at the membrane of cone cells, secondary and tertiary pigment cells, bristle precursor cells and rhabdomeres (PubMed:8666669). Expressed in the salivary glands of third instar larvae (at protein level) (PubMed:28554770).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0011661 Expressed in embryonic/larval hemocyte (Drosophila) and 57 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P46150 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P46150 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with wgn (PubMed:23544124).

Interacts with Mer and arm at the adherens junction (PubMed:8666669).

Interacts with cytoskeletal actin at apical buds of microvilli in the precellularised embryo (PubMed:8666669).

Interacts with PCID2 (possibly via FERM domain) (PubMed:28554770).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q6XK193EBI-206152,EBI-2890448

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
58274, 143 interactors

Database of interacting proteins

More...
DIPi
DIP-52150N

Protein interaction database and analysis system

More...
IntActi
P46150, 15 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0071213

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P46150

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 296FERMPROSITE-ProRule annotationAdd BLAST296

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00960000186596

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P46150

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P46150

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14473 FERM_B-lobe, 1 hit
cd13194 FERM_C_ERM, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit
1.25.40.1020, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019749 Band_41_domain
IPR011174 ERM
IPR011259 ERM_C_dom
IPR041789 ERM_FERM_C
IPR000798 Ez/rad/moesin-like
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR008954 Moesin_tail_sf
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00769 ERM, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF002305 ERM, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00935 BAND41
PR00661 ERMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00295 B41, 1 hit
SM01196 FERM_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47031 SSF47031, 1 hit
SSF48678 SSF48678, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00660 FERM_1, 1 hit
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform J (identifier: P46150-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPKALNVRV TTMDAELEFA IQSTTTGKQL FDQVVKTIGL REVWFFGLQY
60 70 80 90 100
TDSKGDSTWI KLYKKVMNQD VKKENPLQFR FRAKFYPEDV AEELIQDITL
110 120 130 140 150
RLFYLQVKNA ILTDEIYCPP ETSVLLASYA VQARHGDHNK TTHTAGFLAN
160 170 180 190 200
DRLLPQRVID QHKMSKDEWE QSIMTWWQEH RSMLREDAMM EYLKIAQDLE
210 220 230 240 250
MYGVNYFEIR NKKGTDLWLG VDALGLNIYE QDDRLTPKIG FPWSEIRNIS
260 270 280 290 300
FSEKKFIIKP IDKKAPDFMF FAPRVRINKR ILALCMGNHE LYMRRRKPDT
310 320 330 340 350
IDVQQMKAQA REEKNAKQQE REKLQLALAA RERAEKKQQE YEDRLKQMQE
360 370 380 390 400
DMERSQRDLL EAQDMIRRLE EQLKQLQAAK DELELRQKEL QAMLQRLEEA
410 420 430 440 450
KNMEAVEKLK LEEEIMAKQM EVQRIQDEVN AKDEETKRLQ DEVEDARRKQ
460 470 480 490 500
VIAAEAAAAL LAASTTPQHH HVAEDENENE EELTNGDAGG DVSRDLDTDE
510 520 530 540 550
HIKDPIEDRR TLAERNERLH DQLKALKQDL AQSRDETKET ANDKIHRENV
560 570
RQGRDKYKTL REIRKGNTKR RVDQFENM
Length:578
Mass (Da):68,141
Last modified:November 1, 1997 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i24FBA67A3CDF3809
GO
Isoform A (identifier: P46150-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-5: SPKA → GVNFLLFFFSIWL
     65-65: K → KPESPAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTW

Show »
Length:640
Mass (Da):75,315
Checksum:i2E52FBE24C5A0ACC
GO
Isoform B (identifier: P46150-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-5: SPKA → VVVSDSRVRLPRYGGVSVKRKT
     65-65: K → KPESPAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTW

Show »
Length:649
Mass (Da):76,171
Checksum:i2DD64F7386AE244D
GO
Isoform C (identifier: P46150-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Show »
Length:512
Mass (Da):60,599
Checksum:i68493D42D08078D9
GO
Isoform D (identifier: P46150-2) [UniParc]FASTAAdd to basket
Also known as: E, F, G, H, I

The sequence of this isoform differs from the canonical sequence as follows:
     451-453: Missing.

Show »
Length:575
Mass (Da):67,858
Checksum:iC2C80F476CC1A464
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9NG50M9NG50_DROME
Moesin, isoform L
Moe anon-WO03040301.155, anon-WO03040301.157, anon-WO03040301.159, anon-WO03040301.161, D17
578Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PHG2M9PHG2_DROME
Moesin, isoform M
Moe anon-WO03040301.155, anon-WO03040301.157, anon-WO03040301.159, anon-WO03040301.161, D17
584Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C7LAH9C7LAH9_DROME
Moesin, isoform K
Moe anon-WO03040301.155, anon-WO03040301.157, anon-WO03040301.159, anon-WO03040301.161, D17
646Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti217 – 219LWL → SLV in AAA65059 (Ref. 6) Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0358631 – 66Missing in isoform C. CuratedAdd BLAST66
Alternative sequenceiVSP_0358642 – 5SPKA → GVNFLLFFFSIWL in isoform A. Curated4
Alternative sequenceiVSP_0358652 – 5SPKA → VVVSDSRVRLPRYGGVSVKR KT in isoform B. Curated4
Alternative sequenceiVSP_03586665K → KPESPAIKTIKYLKRVKKYV DKKTADSNGVNHLETSEEDD DADDMTGSMPFSTW in isoform A and isoform B. Curated1
Alternative sequenceiVSP_007499451 – 453Missing in isoform D. 2 Publications3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L38909 mRNA Translation: AAB48934.1
AE014298 Genomic DNA Translation: AAF46415.2
AE014298 Genomic DNA Translation: AAF46416.1
AE014298 Genomic DNA Translation: AAF46417.1
AE014298 Genomic DNA Translation: AAF46418.1
AE014298 Genomic DNA Translation: AAS65294.1
AE014298 Genomic DNA Translation: AAS65295.1
AE014298 Genomic DNA Translation: AAS65296.1
AE014298 Genomic DNA Translation: AAS65297.1
AE014298 Genomic DNA Translation: AAS65298.1
AE014298 Genomic DNA Translation: AAS65299.1
AY069855 mRNA Translation: AAL40000.1
U23798 mRNA Translation: AAA65059.1
U08218 mRNA Translation: AAA19857.1

NCBI Reference Sequences

More...
RefSeqi
NP_001245584.1, NM_001258655.1 [P46150-1]
NP_525082.2, NM_080343.4 [P46150-2]
NP_727290.1, NM_167168.4 [P46150-4]
NP_727291.1, NM_167169.2 [P46150-3]
NP_727292.1, NM_167170.2 [P46150-5]
NP_996387.1, NM_206664.3 [P46150-1]
NP_996388.1, NM_206665.3 [P46150-2]
NP_996389.1, NM_206666.3 [P46150-2]
NP_996390.1, NM_206667.3 [P46150-2]
NP_996391.1, NM_206668.3 [P46150-2]
NP_996392.1, NM_206669.2 [P46150-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0071269; FBpp0071212; FBgn0011661 [P46150-2]
FBtr0071270; FBpp0071213; FBgn0011661 [P46150-4]
FBtr0071271; FBpp0071214; FBgn0011661 [P46150-3]
FBtr0071272; FBpp0071215; FBgn0011661 [P46150-5]
FBtr0071273; FBpp0089231; FBgn0011661 [P46150-2]
FBtr0071274; FBpp0089232; FBgn0011661 [P46150-2]
FBtr0071275; FBpp0089233; FBgn0011661 [P46150-2]
FBtr0071276; FBpp0089234; FBgn0011661 [P46150-2]
FBtr0071277; FBpp0089235; FBgn0011661 [P46150-2]
FBtr0071278; FBpp0089236; FBgn0011661 [P46150-1]
FBtr0308194; FBpp0300514; FBgn0011661 [P46150-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
31816

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG10701

UCSC genome browser

More...
UCSCi
CG10701-RA d. melanogaster
CG10701-RB d. melanogaster
CG10701-RC d. melanogaster
CG10701-RE d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L38909 mRNA Translation: AAB48934.1
AE014298 Genomic DNA Translation: AAF46415.2
AE014298 Genomic DNA Translation: AAF46416.1
AE014298 Genomic DNA Translation: AAF46417.1
AE014298 Genomic DNA Translation: AAF46418.1
AE014298 Genomic DNA Translation: AAS65294.1
AE014298 Genomic DNA Translation: AAS65295.1
AE014298 Genomic DNA Translation: AAS65296.1
AE014298 Genomic DNA Translation: AAS65297.1
AE014298 Genomic DNA Translation: AAS65298.1
AE014298 Genomic DNA Translation: AAS65299.1
AY069855 mRNA Translation: AAL40000.1
U23798 mRNA Translation: AAA65059.1
U08218 mRNA Translation: AAA19857.1
RefSeqiNP_001245584.1, NM_001258655.1 [P46150-1]
NP_525082.2, NM_080343.4 [P46150-2]
NP_727290.1, NM_167168.4 [P46150-4]
NP_727291.1, NM_167169.2 [P46150-3]
NP_727292.1, NM_167170.2 [P46150-5]
NP_996387.1, NM_206664.3 [P46150-1]
NP_996388.1, NM_206665.3 [P46150-2]
NP_996389.1, NM_206666.3 [P46150-2]
NP_996390.1, NM_206667.3 [P46150-2]
NP_996391.1, NM_206668.3 [P46150-2]
NP_996392.1, NM_206669.2 [P46150-2]

3D structure databases

SMRiP46150
ModBaseiSearch...

Protein-protein interaction databases

BioGridi58274, 143 interactors
DIPiDIP-52150N
IntActiP46150, 15 interactors
STRINGi7227.FBpp0071213

Protein family/group databases

TCDBi8.A.25.1.4 the ezrin/radixin/moesin (ezrin) family

PTM databases

iPTMnetiP46150

Proteomic databases

PRIDEiP46150

Genome annotation databases

EnsemblMetazoaiFBtr0071269; FBpp0071212; FBgn0011661 [P46150-2]
FBtr0071270; FBpp0071213; FBgn0011661 [P46150-4]
FBtr0071271; FBpp0071214; FBgn0011661 [P46150-3]
FBtr0071272; FBpp0071215; FBgn0011661 [P46150-5]
FBtr0071273; FBpp0089231; FBgn0011661 [P46150-2]
FBtr0071274; FBpp0089232; FBgn0011661 [P46150-2]
FBtr0071275; FBpp0089233; FBgn0011661 [P46150-2]
FBtr0071276; FBpp0089234; FBgn0011661 [P46150-2]
FBtr0071277; FBpp0089235; FBgn0011661 [P46150-2]
FBtr0071278; FBpp0089236; FBgn0011661 [P46150-1]
FBtr0308194; FBpp0300514; FBgn0011661 [P46150-1]
GeneIDi31816
KEGGidme:Dmel_CG10701
UCSCiCG10701-RA d. melanogaster
CG10701-RB d. melanogaster
CG10701-RC d. melanogaster
CG10701-RE d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
31816
FlyBaseiFBgn0011661 Moe

Phylogenomic databases

GeneTreeiENSGT00960000186596
InParanoidiP46150
PhylomeDBiP46150

Enzyme and pathway databases

ReactomeiR-DME-373752 Netrin-1 signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Moe fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
31816

Protein Ontology

More...
PROi
PR:P46150

Gene expression databases

BgeeiFBgn0011661 Expressed in embryonic/larval hemocyte (Drosophila) and 57 other tissues
ExpressionAtlasiP46150 baseline and differential
GenevisibleiP46150 DM

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
cd13194 FERM_C_ERM, 1 hit
Gene3Di1.20.80.10, 1 hit
1.25.40.1020, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR019749 Band_41_domain
IPR011174 ERM
IPR011259 ERM_C_dom
IPR041789 ERM_FERM_C
IPR000798 Ez/rad/moesin-like
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR008954 Moesin_tail_sf
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00769 ERM, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PIRSFiPIRSF002305 ERM, 1 hit
PRINTSiPR00935 BAND41
PR00661 ERMFAMILY
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01196 FERM_C, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF48678 SSF48678, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00660 FERM_1, 1 hit
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMOEH_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P46150
Secondary accession number(s): A4V458
, P91930, Q24053, Q24435, Q7KVS6, Q7KVS7, Q9W3B4, Q9W3B5, Q9W3B6, Q9W3B7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1997
Last modified: February 26, 2020
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again