Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase

Gene

NOP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in ribosomal large subunit assembly (PubMed:24120868). S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the C5 position of cytosine 4447 in 28S rRNA (Probable). May play a role in the regulation of the cell cycle and the increased nucleolar activity that is associated with the cell proliferation (Probable).Curated1 Publication

Catalytic activityi

S-adenosyl-L-methionine + cytosine(4447) in 28S rRNA = S-adenosyl-L-homocysteine + C5-methylcytosine(4447) in 28S rRNA.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei416S-adenosyl-L-methioninePROSITE-ProRule annotation1
Binding sitei443S-adenosyl-L-methioninePROSITE-ProRule annotation1
Binding sitei460S-adenosyl-L-methioninePROSITE-ProRule annotation1
Active sitei517NucleophilePROSITE-ProRule annotation1

GO - Molecular functioni

  • RNA binding Source: UniProtKB
  • rRNA (cytosine-C5-)-methyltransferase activity Source: GO_Central

GO - Biological processi

  • positive regulation of cell proliferation Source: GO_Central
  • regulation of signal transduction by p53 class mediator Source: UniProtKB
  • regulation of transcription by RNA polymerase II Source: Reactome
  • ribosomal large subunit assembly Source: UniProtKB
  • rRNA base methylation Source: GO_Central

Keywordsi

Molecular functionMethyltransferase, RNA-binding, Transferase
Biological processRibosome biogenesis, rRNA processing
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

ReactomeiR-HSA-6790901 rRNA modification in the nucleus and cytosol
R-HSA-8869496 TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase (EC:2.1.1.-1 Publication)
Alternative name(s):
Nucleolar protein 1
Nucleolar protein 2 homolog
Proliferating-cell nucleolar antigen p120
Proliferation-associated nucleolar protein p120
Gene namesi
Name:NOP2
Synonyms:NOL1, NSUN1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000111641.10
HGNCiHGNC:7867 NOP2
MIMi164031 gene
neXtProtiNX_P46087

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi4839
OpenTargetsiENSG00000111641
PharmGKBiPA164724026

Polymorphism and mutation databases

BioMutaiNOP2
DMDMi146289861

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002118181 – 812Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferaseAdd BLAST812

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei36PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei67PhosphoserineCombined sources1
Cross-linki71Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei102CitrullineBy similarity1
Modified residuei164CitrullineBy similarity1
Modified residuei181PhosphoserineCombined sources1
Modified residuei185PhosphothreonineCombined sources1
Modified residuei195PhosphothreonineCombined sources1
Cross-linki272Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei649N6-acetyllysineCombined sources1
Modified residuei666PhosphoserineCombined sources1
Modified residuei675PhosphoserineCombined sources1
Modified residuei732PhosphoserineCombined sources1
Modified residuei734PhosphoserineCombined sources1
Modified residuei739PhosphothreonineCombined sources1
Modified residuei776PhosphothreonineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Modified residuei801PhosphoserineCombined sources1
Modified residuei812PhosphoserineCombined sources1

Post-translational modificationi

Citrullinated by PADI4.By similarity

Keywords - PTMi

Acetylation, Citrullination, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP46087
MaxQBiP46087
PaxDbiP46087
PeptideAtlasiP46087
PRIDEiP46087
ProteomicsDBi55714
55715 [P46087-2]
TopDownProteomicsiP46087-2 [P46087-2]

2D gel databases

SWISS-2DPAGEiP46087

PTM databases

iPTMnetiP46087
PhosphoSitePlusiP46087
SwissPalmiP46087

Expressioni

Developmental stagei

Expressed in G1 and peaks during the early S phase of the cell cycle.1 Publication

Gene expression databases

BgeeiENSG00000111641 Expressed in 109 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_NOP2
ExpressionAtlasiP46087 baseline and differential
GenevisibleiP46087 HS

Organism-specific databases

HPAiHPA040119

Interactioni

Subunit structurei

Interacts with MCRS1 (PubMed:9654073). Interacts with WDR46 (PubMed:23848194). Interacts with RRP1B (PubMed:20926688).3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi110902, 164 interactors
IntActiP46087, 50 interactors
MINTiP46087
STRINGi9606.ENSP00000382392

Structurei

3D structure databases

ProteinModelPortaliP46087
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni392 – 398S-adenosyl-L-methionine bindingPROSITE-ProRule annotation7

Sequence similaritiesi

Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1122 Eukaryota
COG0144 LUCA
GeneTreeiENSGT00660000095341
HOGENOMiHOG000224258
HOVERGENiHBG082043
InParanoidiP46087
KOiK14835
OMAiVQRCYNL
PhylomeDBiP46087
TreeFamiTF105660

Family and domain databases

InterProiView protein in InterPro
IPR018314 Fmu/NOL1/Nop2p_CS
IPR031341 Methyltr_RsmF_N
IPR001678 MeTrfase_RsmB/NOP2
IPR011023 Nop2p
IPR012586 P120R_rpt
IPR023267 RCMT
IPR023273 RCMT_NOP2
IPR029063 SAM-dependent_MTases
PfamiView protein in Pfam
PF01189 Methyltr_RsmB-F, 1 hit
PF17125 Methyltr_RsmF_N, 1 hit
PF08062 P120R, 3 hits
PRINTSiPR02008 RCMTFAMILY
PR02012 RCMTNOP2
SUPFAMiSSF53335 SSF53335, 1 hit
TIGRFAMsiTIGR00446 nop2p, 1 hit
PROSITEiView protein in PROSITE
PS01153 NOL1_NOP2_SUN, 1 hit
PS51686 SAM_MT_RSMB_NOP, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P46087-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRKLDPTKE KRGPGRKARK QKGAETELVR FLPAVSDENS KRLSSRARKR
60 70 80 90 100
AAKRRLGSVE APKTNKSPEA KPLPGKLPKG ISAGAVQTAG KKGPQSLFNA
110 120 130 140 150
PRGKKRPAPG SDEEEEEEDS EEDGMVNHGD LWGSEDDADT VDDYGADSNS
160 170 180 190 200
EDEEEGEALL PIERAARKQK AREAAAGIQW SEEETEDEEE EKEVTPESGP
210 220 230 240 250
PKVEEADGGL QINVDEEPFV LPPAGEMEQD AQAPDLQRVH KRIQDIVGIL
260 270 280 290 300
RDFGAQREEG RSRSEYLNRL KKDLAIYYSY GDFLLGKLMD LFPLSELVEF
310 320 330 340 350
LEANEVPRPV TLRTNTLKTR RRDLAQALIN RGVNLDPLGK WSKTGLVVYD
360 370 380 390 400
SSVPIGATPE YLAGHYMLQG ASSMLPVMAL APQEHERILD MCCAPGGKTS
410 420 430 440 450
YMAQLMKNTG VILANDANAE RLKSVVGNLH RLGVTNTIIS HYDGRQFPKV
460 470 480 490 500
VGGFDRVLLD APCSGTGVIS KDPAVKTNKD EKDILRCAHL QKELLLSAID
510 520 530 540 550
SVNATSKTGG YLVYCTCSIT VEENEWVVDY ALKKRNVRLV PTGLDFGQEG
560 570 580 590 600
FTRFRERRFH PSLRSTRRFY PHTHNMDGFF IAKFKKFSNS IPQSQTGNSE
610 620 630 640 650
TATPTNVDLP QVIPKSENSS QPAKKAKGAA KTKQQLQKQQ HPKKASFQKL
660 670 680 690 700
NGISKGADSE LSTVPSVTKT QASSSFQDSS QPAGKAEGIR EPKVTGKLKQ
710 720 730 740 750
RSPKLQSSKK VAFLRQNAPP KGTDTQTPAV LSPSKTQATL KPKDHHQPLG
760 770 780 790 800
RAKGVEKQQL PEQPFEKAAF QKQNDTPKGP QPPTVSPIRS SRPPPAKRKK
810
SQSRGNSQLL LS
Length:812
Mass (Da):89,302
Last modified:March 6, 2007 - v2
Checksum:i4C7A1BE79388F1C5
GO
Isoform 2 (identifier: P46087-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-84: Missing.

Show »
Length:808
Mass (Da):88,973
Checksum:i5984B2D2A8F64780
GO
Isoform 3 (identifier: P46087-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-84: Missing.
     597-812: GNSETATPTN...SRGNSQLLLS → DGVLLCRSGW...QAILVPQTPK

Show »
Length:628
Mass (Da):69,615
Checksum:iF29EB2BF00FC514F
GO
Isoform 4 (identifier: P46087-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-158: A → AAGVQWLGLGSLQPPPPGFKQFSCLSFPSSWDLQ

Show »
Length:845
Mass (Da):92,860
Checksum:iB3AD501991F1F8F4
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYR3F5GYR3_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
275Annotation score:
F5H8G6F5H8G6_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
98Annotation score:
F5GWB7F5GWB7_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
159Annotation score:
F5H5X6F5H5X6_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
250Annotation score:
F5H709F5H709_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
176Annotation score:
F5H359F5H359_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
81Annotation score:

Sequence cautioni

The sequence AAA36398 differs from that shown. Reason: Frameshift at position 780.Curated
The sequence CAA39119 differs from that shown. Reason: Frameshift at position 780.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti559F → L in AAI28185 (PubMed:15489334).Curated1
Sequence conflicti630A → G in AAA36398 (PubMed:2576976).Curated1
Sequence conflicti760 – 761LP → FA in AAA36398 (PubMed:2576976).Curated2
Sequence conflicti760 – 761LP → FA in CAA39119 (PubMed:1394192).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03093873L → S2 PublicationsCorresponds to variant dbSNP:rs1128164Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02349481 – 84Missing in isoform 2 and isoform 3. 2 Publications4
Alternative sequenceiVSP_045308158A → AAGVQWLGLGSLQPPPPGFK QFSCLSFPSSWDLQ in isoform 4. 1 Publication1
Alternative sequenceiVSP_045309597 – 812GNSET…QLLLS → DGVLLCRSGWTAVVQSQLIA TSTFQVQAILVPQTPK in isoform 3. 1 PublicationAdd BLAST216

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M32110 mRNA Translation: AAA36398.1 Sequence problems.
M33132 Genomic DNA No translation available.
X55504 mRNA Translation: CAA39119.1 Frameshift.
AK056208 mRNA Translation: BAG51648.1
AC006064 Genomic DNA No translation available.
BC082985 mRNA Translation: AAH82985.1
BC000656 mRNA Translation: AAH00656.1
BC065257 mRNA Translation: AAH65257.1
BC106072 mRNA Translation: AAI06073.1
BC128183 mRNA Translation: AAI28184.1
BC128184 mRNA Translation: AAI28185.1
CCDSiCCDS44811.1 [P46087-2]
CCDS58202.1 [P46087-3]
CCDS58203.1 [P46087-1]
CCDS58204.1 [P46087-4]
PIRiA48168
RefSeqiNP_001028886.1, NM_001033714.2 [P46087-2]
NP_001245237.1, NM_001258308.1 [P46087-1]
NP_001245238.1, NM_001258309.1 [P46087-4]
NP_001245239.1, NM_001258310.1 [P46087-3]
NP_006161.2, NM_006170.3 [P46087-2]
XP_005253748.1, XM_005253691.1 [P46087-1]
UniGeneiHs.534334

Genome annotation databases

EnsembliENST00000322166; ENSP00000313272; ENSG00000111641 [P46087-1]
ENST00000382421; ENSP00000371858; ENSG00000111641 [P46087-4]
ENST00000399466; ENSP00000382392; ENSG00000111641 [P46087-2]
ENST00000537442; ENSP00000444437; ENSG00000111641 [P46087-1]
ENST00000541778; ENSP00000443150; ENSG00000111641 [P46087-2]
ENST00000545200; ENSP00000439422; ENSG00000111641 [P46087-3]
ENST00000617555; ENSP00000484384; ENSG00000111641 [P46087-3]
ENST00000620535; ENSP00000479320; ENSG00000111641 [P46087-4]
GeneIDi4839
KEGGihsa:4839
UCSCiuc031yro.1 human [P46087-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M32110 mRNA Translation: AAA36398.1 Sequence problems.
M33132 Genomic DNA No translation available.
X55504 mRNA Translation: CAA39119.1 Frameshift.
AK056208 mRNA Translation: BAG51648.1
AC006064 Genomic DNA No translation available.
BC082985 mRNA Translation: AAH82985.1
BC000656 mRNA Translation: AAH00656.1
BC065257 mRNA Translation: AAH65257.1
BC106072 mRNA Translation: AAI06073.1
BC128183 mRNA Translation: AAI28184.1
BC128184 mRNA Translation: AAI28185.1
CCDSiCCDS44811.1 [P46087-2]
CCDS58202.1 [P46087-3]
CCDS58203.1 [P46087-1]
CCDS58204.1 [P46087-4]
PIRiA48168
RefSeqiNP_001028886.1, NM_001033714.2 [P46087-2]
NP_001245237.1, NM_001258308.1 [P46087-1]
NP_001245238.1, NM_001258309.1 [P46087-4]
NP_001245239.1, NM_001258310.1 [P46087-3]
NP_006161.2, NM_006170.3 [P46087-2]
XP_005253748.1, XM_005253691.1 [P46087-1]
UniGeneiHs.534334

3D structure databases

ProteinModelPortaliP46087
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110902, 164 interactors
IntActiP46087, 50 interactors
MINTiP46087
STRINGi9606.ENSP00000382392

PTM databases

iPTMnetiP46087
PhosphoSitePlusiP46087
SwissPalmiP46087

Polymorphism and mutation databases

BioMutaiNOP2
DMDMi146289861

2D gel databases

SWISS-2DPAGEiP46087

Proteomic databases

EPDiP46087
MaxQBiP46087
PaxDbiP46087
PeptideAtlasiP46087
PRIDEiP46087
ProteomicsDBi55714
55715 [P46087-2]
TopDownProteomicsiP46087-2 [P46087-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000322166; ENSP00000313272; ENSG00000111641 [P46087-1]
ENST00000382421; ENSP00000371858; ENSG00000111641 [P46087-4]
ENST00000399466; ENSP00000382392; ENSG00000111641 [P46087-2]
ENST00000537442; ENSP00000444437; ENSG00000111641 [P46087-1]
ENST00000541778; ENSP00000443150; ENSG00000111641 [P46087-2]
ENST00000545200; ENSP00000439422; ENSG00000111641 [P46087-3]
ENST00000617555; ENSP00000484384; ENSG00000111641 [P46087-3]
ENST00000620535; ENSP00000479320; ENSG00000111641 [P46087-4]
GeneIDi4839
KEGGihsa:4839
UCSCiuc031yro.1 human [P46087-1]

Organism-specific databases

CTDi4839
DisGeNETi4839
EuPathDBiHostDB:ENSG00000111641.10
GeneCardsiNOP2
HGNCiHGNC:7867 NOP2
HPAiHPA040119
MIMi164031 gene
neXtProtiNX_P46087
OpenTargetsiENSG00000111641
PharmGKBiPA164724026
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1122 Eukaryota
COG0144 LUCA
GeneTreeiENSGT00660000095341
HOGENOMiHOG000224258
HOVERGENiHBG082043
InParanoidiP46087
KOiK14835
OMAiVQRCYNL
PhylomeDBiP46087
TreeFamiTF105660

Enzyme and pathway databases

ReactomeiR-HSA-6790901 rRNA modification in the nucleus and cytosol
R-HSA-8869496 TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

Miscellaneous databases

ChiTaRSiNOP2 human
GeneWikiiNOL1
GenomeRNAii4839
PROiPR:P46087
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111641 Expressed in 109 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_NOP2
ExpressionAtlasiP46087 baseline and differential
GenevisibleiP46087 HS

Family and domain databases

InterProiView protein in InterPro
IPR018314 Fmu/NOL1/Nop2p_CS
IPR031341 Methyltr_RsmF_N
IPR001678 MeTrfase_RsmB/NOP2
IPR011023 Nop2p
IPR012586 P120R_rpt
IPR023267 RCMT
IPR023273 RCMT_NOP2
IPR029063 SAM-dependent_MTases
PfamiView protein in Pfam
PF01189 Methyltr_RsmB-F, 1 hit
PF17125 Methyltr_RsmF_N, 1 hit
PF08062 P120R, 3 hits
PRINTSiPR02008 RCMTFAMILY
PR02012 RCMTNOP2
SUPFAMiSSF53335 SSF53335, 1 hit
TIGRFAMsiTIGR00446 nop2p, 1 hit
PROSITEiView protein in PROSITE
PS01153 NOL1_NOP2_SUN, 1 hit
PS51686 SAM_MT_RSMB_NOP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNOP2_HUMAN
AccessioniPrimary (citable) accession number: P46087
Secondary accession number(s): A1A4Z3
, B3KPD6, Q05BA7, Q0P5S5, Q3KQS4, Q58F30
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: March 6, 2007
Last modified: November 7, 2018
This is version 179 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again