Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P46087 (NOP2_HUMAN)

Entry version 198 (07 Apr 2021)
Sequence version 2 (06 Mar 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase

Gene

NOP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in ribosomal large subunit assembly (PubMed:24120868). S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the C5 position of cytosine 4447 in 28S rRNA (Probable). May play a role in the regulation of the cell cycle and the increased nucleolar activity that is associated with the cell proliferation (Probable).Curated1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei416S-adenosyl-L-methioninePROSITE-ProRule annotation1
Binding sitei443S-adenosyl-L-methioninePROSITE-ProRule annotation1
Binding sitei460S-adenosyl-L-methioninePROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei517NucleophilePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, RNA-binding, Transferase
Biological processRibosome biogenesis, rRNA processing
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P46087

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6790901, rRNA modification in the nucleus and cytosol
R-HSA-8869496, TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase (EC:2.1.1.-1 Publication)
Alternative name(s):
Nucleolar protein 1
Nucleolar protein 2 homolog
Proliferating-cell nucleolar antigen p120
Proliferation-associated nucleolar protein p120
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NOP2
Synonyms:NOL1, NSUN1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7867, NOP2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		164031, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P46087

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000111641.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		4839

Open Targets

More...OpenTargetsi		ENSG00000111641

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA164724026

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P46087, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NOP2

Domain mapping of disease mutations (DMDM)

More...DMDMi		146289861

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002118181 – 812Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferaseAdd BLAST812

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei36PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei67PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki71Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei102CitrullineBy similarity1
Modified residuei164CitrullineBy similarity1
Modified residuei181PhosphoserineCombined sources1
Modified residuei185PhosphothreonineCombined sources1
Modified residuei195PhosphothreonineCombined sources1
Cross-linki272Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei649N6-acetyllysineCombined sources1
Modified residuei666PhosphoserineCombined sources1
Modified residuei675PhosphoserineCombined sources1
Modified residuei732PhosphoserineCombined sources1
Modified residuei734PhosphoserineCombined sources1
Modified residuei739PhosphothreonineCombined sources1
Modified residuei776PhosphothreonineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Modified residuei801PhosphoserineCombined sources1
Modified residuei812PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Citrullinated by PADI4.By similarity

Keywords - PTMi

Acetylation, Citrullination, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P46087

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P46087

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P46087

MaxQB - The MaxQuant DataBase

More...MaxQBi		P46087

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P46087

PeptideAtlas

More...PeptideAtlasi		P46087

PRoteomics IDEntifications database

More...PRIDEi		P46087

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55714 [P46087-1]
55715 [P46087-2]
58366
61721

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P46087-2 [P46087-2]

2D gel databases

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...SWISS-2DPAGEi		P46087

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P46087, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P46087

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P46087

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P46087

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in G1 and peaks during the early S phase of the cell cycle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000111641, Expressed in left lobe of thyroid gland and 129 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P46087, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P46087, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000111641, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MCRS1 (PubMed:9654073).

Interacts with WDR46 (PubMed:23848194).

Interacts with RRP1B (PubMed:20926688).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110902, 250 interactors

Protein interaction database and analysis system

More...IntActi		P46087, 109 interactors

Molecular INTeraction database

More...MINTi		P46087

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000371858

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P46087, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni392 – 398S-adenosyl-L-methionine bindingPROSITE-ProRule annotation7

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1122, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155370

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_005316_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P46087

Identification of Orthologs from Complete Genome Data

More...OMAi		VQRCYNL

Database of Orthologous Groups

More...OrthoDBi		1528896at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P46087

TreeFam database of animal gene trees

More...TreeFami		TF105660

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018314, Fmu/NOL1/Nop2p_CS
IPR031341, Methyltr_RsmF_N
IPR001678, MeTrfase_RsmB/NOP2
IPR011023, Nop2p
IPR012586, P120R_rpt
IPR023267, RCMT
IPR023273, RCMT_NOP2
IPR029063, SAM-dependent_MTases

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01189, Methyltr_RsmB-F, 1 hit
PF17125, Methyltr_RsmF_N, 1 hit
PF08062, P120R, 3 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR02008, RCMTFAMILY
PR02012, RCMTNOP2

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53335, SSF53335, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00446, nop2p, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01153, NOL1_NOP2_SUN, 1 hit
PS51686, SAM_MT_RSMB_NOP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P46087-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRKLDPTKE KRGPGRKARK QKGAETELVR FLPAVSDENS KRLSSRARKR 
        60         70         80         90        100
AAKRRLGSVE APKTNKSPEA KPLPGKLPKG ISAGAVQTAG KKGPQSLFNA 
       110        120        130        140        150
PRGKKRPAPG SDEEEEEEDS EEDGMVNHGD LWGSEDDADT VDDYGADSNS 
       160        170        180        190        200
EDEEEGEALL PIERAARKQK AREAAAGIQW SEEETEDEEE EKEVTPESGP 
       210        220        230        240        250
PKVEEADGGL QINVDEEPFV LPPAGEMEQD AQAPDLQRVH KRIQDIVGIL 
       260        270        280        290        300
RDFGAQREEG RSRSEYLNRL KKDLAIYYSY GDFLLGKLMD LFPLSELVEF 
       310        320        330        340        350
LEANEVPRPV TLRTNTLKTR RRDLAQALIN RGVNLDPLGK WSKTGLVVYD 
       360        370        380        390        400
SSVPIGATPE YLAGHYMLQG ASSMLPVMAL APQEHERILD MCCAPGGKTS 
       410        420        430        440        450
YMAQLMKNTG VILANDANAE RLKSVVGNLH RLGVTNTIIS HYDGRQFPKV 
       460        470        480        490        500
VGGFDRVLLD APCSGTGVIS KDPAVKTNKD EKDILRCAHL QKELLLSAID 
       510        520        530        540        550
SVNATSKTGG YLVYCTCSIT VEENEWVVDY ALKKRNVRLV PTGLDFGQEG 
       560        570        580        590        600
FTRFRERRFH PSLRSTRRFY PHTHNMDGFF IAKFKKFSNS IPQSQTGNSE 
       610        620        630        640        650
TATPTNVDLP QVIPKSENSS QPAKKAKGAA KTKQQLQKQQ HPKKASFQKL 
       660        670        680        690        700
NGISKGADSE LSTVPSVTKT QASSSFQDSS QPAGKAEGIR EPKVTGKLKQ 
       710        720        730        740        750
RSPKLQSSKK VAFLRQNAPP KGTDTQTPAV LSPSKTQATL KPKDHHQPLG 
       760        770        780        790        800
RAKGVEKQQL PEQPFEKAAF QKQNDTPKGP QPPTVSPIRS SRPPPAKRKK 
       810 
SQSRGNSQLL LS
Length:812
Mass (Da):89,302
Last modified:March 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C7A1BE79388F1C5
GO
Isoform 2 (identifier: P46087-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-84: Missing.

Show »
Length:808
Mass (Da):88,973
Checksum:i5984B2D2A8F64780
GO
Isoform 3 (identifier: P46087-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-84: Missing.
     597-812: GNSETATPTN...SRGNSQLLLS → DGVLLCRSGW...QAILVPQTPK

Show »
Length:628
Mass (Da):69,615
Checksum:iF29EB2BF00FC514F
GO
Isoform 4 (identifier: P46087-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-158: A → AAGVQWLGLGSLQPPPPGFKQFSCLSFPSSWDLQ

Show »
Length:845
Mass (Da):92,860
Checksum:iB3AD501991F1F8F4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYR3F5GYR3_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
275Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H359F5H359_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5X6F5H5X6_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GWB7F5GWB7_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H709F5H709_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H8G6F5H8G6_HUMAN
Probable 28S rRNA (cytosine(4447)-C...
NOP2
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA36398 differs from that shown. Reason: Frameshift.Curated
The sequence CAA39119 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti559F → L in AAI28185 (PubMed:15489334).Curated1
Sequence conflicti630A → G in AAA36398 (PubMed:2576976).Curated1
Sequence conflicti760 – 761LP → FA in AAA36398 (PubMed:2576976).Curated2
Sequence conflicti760 – 761LP → FA in CAA39119 (PubMed:1394192).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03093873L → S2 PublicationsCorresponds to variant dbSNP:rs1128164Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02349481 – 84Missing in isoform 2 and isoform 3. 2 Publications4
Alternative sequenceiVSP_045308158A → AAGVQWLGLGSLQPPPPGFK QFSCLSFPSSWDLQ in isoform 4. 1 Publication1
Alternative sequenceiVSP_045309597 – 812GNSET…QLLLS → DGVLLCRSGWTAVVQSQLIA TSTFQVQAILVPQTPK in isoform 3. 1 PublicationAdd BLAST216

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M32110 mRNA Translation: AAA36398.1 Sequence problems.
M33132 Genomic DNA No translation available.
X55504 mRNA Translation: CAA39119.1 Frameshift.
AK056208 mRNA Translation: BAG51648.1
AC006064 Genomic DNA No translation available.
BC082985 mRNA Translation: AAH82985.1
BC000656 mRNA Translation: AAH00656.1
BC065257 mRNA Translation: AAH65257.1
BC106072 mRNA Translation: AAI06073.1
BC128183 mRNA Translation: AAI28184.1
BC128184 mRNA Translation: AAI28185.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44811.1 [P46087-2]
CCDS58202.1 [P46087-3]
CCDS58203.1 [P46087-1]
CCDS58204.1 [P46087-4]

Protein sequence database of the Protein Information Resource

More...PIRi		A48168

NCBI Reference Sequences

More...RefSeqi		NP_001028886.1, NM_001033714.2 [P46087-2]
NP_001245237.1, NM_001258308.1 [P46087-1]
NP_001245238.1, NM_001258309.1 [P46087-4]
NP_001245239.1, NM_001258310.1 [P46087-3]
NP_006161.2, NM_006170.3 [P46087-2]
XP_005253748.1, XM_005253691.1 [P46087-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000322166; ENSP00000313272; ENSG00000111641 [P46087-1]
ENST00000382421; ENSP00000371858; ENSG00000111641 [P46087-4]
ENST00000399466; ENSP00000382392; ENSG00000111641 [P46087-2]
ENST00000537442; ENSP00000444437; ENSG00000111641 [P46087-1]
ENST00000541778; ENSP00000443150; ENSG00000111641 [P46087-2]
ENST00000545200; ENSP00000439422; ENSG00000111641 [P46087-3]
ENST00000617555; ENSP00000484384; ENSG00000111641 [P46087-3]
ENST00000620535; ENSP00000479320; ENSG00000111641 [P46087-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4839

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4839

UCSC genome browser

More...UCSCi		uc031yro.1, human [P46087-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M32110 mRNA Translation: AAA36398.1 Sequence problems.
M33132 Genomic DNA No translation available.
X55504 mRNA Translation: CAA39119.1 Frameshift.
AK056208 mRNA Translation: BAG51648.1
AC006064 Genomic DNA No translation available.
BC082985 mRNA Translation: AAH82985.1
BC000656 mRNA Translation: AAH00656.1
BC065257 mRNA Translation: AAH65257.1
BC106072 mRNA Translation: AAI06073.1
BC128183 mRNA Translation: AAI28184.1
BC128184 mRNA Translation: AAI28185.1
CCDSiCCDS44811.1 [P46087-2]
CCDS58202.1 [P46087-3]
CCDS58203.1 [P46087-1]
CCDS58204.1 [P46087-4]
PIRiA48168
RefSeqiNP_001028886.1, NM_001033714.2 [P46087-2]
NP_001245237.1, NM_001258308.1 [P46087-1]
NP_001245238.1, NM_001258309.1 [P46087-4]
NP_001245239.1, NM_001258310.1 [P46087-3]
NP_006161.2, NM_006170.3 [P46087-2]
XP_005253748.1, XM_005253691.1 [P46087-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi110902, 250 interactors
IntActiP46087, 109 interactors
MINTiP46087
STRINGi9606.ENSP00000371858

PTM databases

GlyGeniP46087, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP46087
PhosphoSitePlusiP46087
SwissPalmiP46087

Genetic variation databases

BioMutaiNOP2
DMDMi146289861

2D gel databases

SWISS-2DPAGEiP46087

Proteomic databases

EPDiP46087
jPOSTiP46087
MassIVEiP46087
MaxQBiP46087
PaxDbiP46087
PeptideAtlasiP46087
PRIDEiP46087
ProteomicsDBi55714 [P46087-1]
55715 [P46087-2]
58366
61721
TopDownProteomicsiP46087-2 [P46087-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		22530, 101 antibodies

Genome annotation databases

EnsembliENST00000322166; ENSP00000313272; ENSG00000111641 [P46087-1]
ENST00000382421; ENSP00000371858; ENSG00000111641 [P46087-4]
ENST00000399466; ENSP00000382392; ENSG00000111641 [P46087-2]
ENST00000537442; ENSP00000444437; ENSG00000111641 [P46087-1]
ENST00000541778; ENSP00000443150; ENSG00000111641 [P46087-2]
ENST00000545200; ENSP00000439422; ENSG00000111641 [P46087-3]
ENST00000617555; ENSP00000484384; ENSG00000111641 [P46087-3]
ENST00000620535; ENSP00000479320; ENSG00000111641 [P46087-4]
GeneIDi4839
KEGGihsa:4839
UCSCiuc031yro.1, human [P46087-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4839
DisGeNETi4839

GeneCards: human genes, protein and diseases

More...GeneCardsi		NOP2
HGNCiHGNC:7867, NOP2
HPAiENSG00000111641, Low tissue specificity
MIMi164031, gene
neXtProtiNX_P46087
OpenTargetsiENSG00000111641
PharmGKBiPA164724026
VEuPathDBiHostDB:ENSG00000111641.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1122, Eukaryota
GeneTreeiENSGT00940000155370
HOGENOMiCLU_005316_2_0_1
InParanoidiP46087
OMAiVQRCYNL
OrthoDBi1528896at2759
PhylomeDBiP46087
TreeFamiTF105660

Enzyme and pathway databases

PathwayCommonsiP46087
ReactomeiR-HSA-6790901, rRNA modification in the nucleus and cytosol
R-HSA-8869496, TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4839, 559 hits in 1007 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NOP2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		NOL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4839
PharosiP46087, Tbio

Protein Ontology

More...PROi		PR:P46087
RNActiP46087, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000111641, Expressed in left lobe of thyroid gland and 129 other tissues
ExpressionAtlasiP46087, baseline and differential
GenevisibleiP46087, HS

Family and domain databases

InterProiView protein in InterPro
IPR018314, Fmu/NOL1/Nop2p_CS
IPR031341, Methyltr_RsmF_N
IPR001678, MeTrfase_RsmB/NOP2
IPR011023, Nop2p
IPR012586, P120R_rpt
IPR023267, RCMT
IPR023273, RCMT_NOP2
IPR029063, SAM-dependent_MTases
PfamiView protein in Pfam
PF01189, Methyltr_RsmB-F, 1 hit
PF17125, Methyltr_RsmF_N, 1 hit
PF08062, P120R, 3 hits
PRINTSiPR02008, RCMTFAMILY
PR02012, RCMTNOP2
SUPFAMiSSF53335, SSF53335, 1 hit
TIGRFAMsiTIGR00446, nop2p, 1 hit
PROSITEiView protein in PROSITE
PS01153, NOL1_NOP2_SUN, 1 hit
PS51686, SAM_MT_RSMB_NOP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNOP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P46087
Secondary accession number(s): A1A4Z3
, B3KPD6, Q05BA7, Q0P5S5, Q3KQS4, Q58F30
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: March 6, 2007
Last modified: April 7, 2021
This is version 198 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again