Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pro-neuregulin-1, membrane-bound isoform

Gene

Nrg1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Binds to ERBB4 and ERBB3. Acts as a ligand for integrins and binds (via EGF domain) to integrins ITGAV:ITGB3 or ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and ERRB3 are essential for NRG1-ERBB signaling (By similarity). Induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2 and AKT1, and ligand-dependent ERBB4 endocytosis is essential for the NRG1-mediated activation of these kinases in neurons (PubMed:17250808).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ErbB-3 class receptor binding Source: UniProtKB
  • growth factor activity Source: UniProtKB-KW
  • integrin binding Source: UniProtKB
  • protein tyrosine kinase activator activity Source: GO_Central
  • receptor tyrosine kinase binding Source: MGI
  • signaling receptor binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pro-neuregulin-1, membrane-bound isoform
Short name:
Pro-NRG1
Cleaved into the following chain:
Alternative name(s):
Acetylcholine receptor-inducing activity
Short name:
ARIA
Glial growth factor
Heregulin
Short name:
HRG
Neu differentiation factor
Sensory and motor neuron-derived factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nrg1
Synonyms:Ndf
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
621341 Nrg1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini14 – 265ExtracellularSequence analysisAdd BLAST252
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei266 – 288Helical; Note=Internal signal sequenceSequence analysisAdd BLAST23
Topological domaini289 – 662CytoplasmicSequence analysisAdd BLAST374

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00000194651 – 131 PublicationAdd BLAST13
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001946614 – 662Pro-neuregulin-1, membrane-bound isoformAdd BLAST649
ChainiPRO_000001946714 – 264Neuregulin-1Add BLAST251

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi57 ↔ 112
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi120N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi126N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi164N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi182 ↔ 196By similarity
Disulfide bondi190 ↔ 210By similarity
Disulfide bondi212 ↔ 221By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
N- and O-glycosylated (By similarity). Extensive glycosylation precedes the proteolytic cleavage.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P43322

PRoteomics IDEntifications database

More...
PRIDEi
P43322

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P43322

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P43322

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Most tissues contain isoform alpha2A and isoform alpha2B. Isoform Alpha2 and isoform beta2 are the predominant forms in mesenchymal and non-neuronal organs. Isoform Beta1 is enriched in brain and spinal cord, but not in muscle and heart. Isoform Alpha2C is highly expressed in spinal cord, moderately in lung, brain, ovary, and stomach, in low amounts in the kidney, skin and heart and not detected in the liver, spleen, and placenta.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The cytoplasmic domain interacts with the LIM domain region of LIMK1 (PubMed:9685409). Forms a ternary complex with ERBB3 and ITGAV:ITGB3 or ITGA6:ITGB4 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000014268

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P43322

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P43322

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 128Ig-like C2-typeAdd BLAST92
Domaini178 – 222EGF-likePROSITE-ProRule annotationAdd BLAST45

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi165 – 177Ser/Thr-richAdd BLAST13

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization.
ERBB receptor binding is elicited entirely by the EGF-like domain.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neuregulin family.Curated

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEU9 Eukaryota
ENOG4110ST7 LUCA

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006531

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P43322

KEGG Orthology (KO)

More...
KOi
K05455

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P43322

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040180 Neuregulin
IPR002154 Neuregulin_C
IPR018250 NRG1

The PANTHER Classification System

More...
PANTHERi
PTHR11100 PTHR11100, 1 hit
PTHR11100:SF7 PTHR11100:SF7, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01089 NEUREGULIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 1 hit
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022 EGF_1, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 8 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform Beta4 (identifier: P43322-1) [UniParc]FASTAAdd to basket
Also known as: NDF42A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSERKEGRGK GKGKKKDRGS RGKPGPAEGD PSPALPPRLK EMKSQESAAG
60 70 80 90 100
SKLVLRCETS SEYSSLRFKW FKNGNELNRK NKPENIKIQK KPGKSELRIN
110 120 130 140 150
KASLADSGEY MCKVISKLGN DSASANITIV ESNEFITGMP ASTETAYVSS
160 170 180 190 200
ESPIRISVST EGANTSSSTS TSTTGTSHLI KCAEKEKTFC VNGGECFTVK
210 220 230 240 250
DLSNPSRYLC KCPNEFTGDR CQNYVMASFY MTSRRKRQET EKPLERKLDH
260 270 280 290 300
SLVKESKAEE LYQKRVLTIT GICIALLVVG IMCVVAYCKT KKQRQKLHDR
310 320 330 340 350
LRQSLRSERS NLVNIANGPH HPNPPPENVQ LVNQYVSKNV ISSEHIVERE
360 370 380 390 400
VETSFSTSHY TSTAHHSTTV TQTPSHSWSN GHTESVISES NSVIMMSSVE
410 420 430 440 450
NSRHSSPAGG PRGRLHGLGG PRDNSFLRHA RETPDSYRDS PHSERYVSAM
460 470 480 490 500
TTPARMSPVD FHTPSSPKSP PSEMSPPVSS MTVSMPSVAV SPFVEEERPL
510 520 530 540 550
LLVTPPRLRE KKYDHHPQQL NSFHHNPAHQ STSLPPSPLR IVEDEEYETT
560 570 580 590 600
QEYESVQEPV KKVTNSRRAK RTKPNGHIAN RLEMDSNTSS VSSNSESETE
610 620 630 640 650
DERVGEDTPF LGIQNPLAAS LEVAPAFRLA ESRTNPAGRF STQEELQARL
660
SSVIANQDPI AV
Length:662
Mass (Da):73,288
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1C31ABCF2A8EB1D5
GO
Isoform Alpha2A (identifier: P43322-2) [UniParc]FASTAAdd to basket
Also known as: NDF38

The sequence of this isoform differs from the canonical sequence as follows:
     213-256: PNEFTGDRCQNYVMASFYMTSRRKRQETEKPLERKLDHSLVKES → QPGFTGARCTENVPMKVQTQE

Show »
Length:639
Mass (Da):70,303
Checksum:i2A5A97DFCE065176
GO
Isoform Alpha2B (identifier: P43322-3) [UniParc]FASTAAdd to basket
Also known as: NDF19

The sequence of this isoform differs from the canonical sequence as follows:
     213-256: PNEFTGDRCQNYVMASFYMTSRRKRQETEKPLERKLDHSLVKES → QPGFTGARCTENVPMKVQTQE
     446-484: YVSAMTTPAR...SPPVSSMTVS → HNLIAELRRN...SSITHLGFIL
     485-662: Missing.

Show »
Length:461
Mass (Da):50,809
Checksum:iBE384394D3C88841
GO
Isoform Alpha2C (identifier: P43322-4) [UniParc]FASTAAdd to basket
Also known as: NDF44

The sequence of this isoform differs from the canonical sequence as follows:
     213-256: PNEFTGDRCQNYVMASFYMTSRRKRQETEKPLERKLDHSLVKES → QPGFTGARCTENVPMKVQTQE
     446-662: Missing.

Show »
Length:422
Mass (Da):46,309
Checksum:iAD15AECCB42C9C45
GO
Isoform Beta1 (identifier: P43322-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-257: MTSRRKRQETEKPLERKLDHSLVKESK → KHLGIEFME

Show »
Length:644
Mass (Da):71,081
Checksum:i2382B5DB8682CE17
GO
Isoform Beta2 (identifier: P43322-6) [UniParc]FASTAAdd to basket
Also known as: NDF40

The sequence of this isoform differs from the canonical sequence as follows:
     231-256: Missing.
     325-330: PPENVQ → RVRTRG

Show »
Length:636
Mass (Da):70,185
Checksum:i2F621966AA232AB9
GO
Isoform BetA2A (identifier: P43322-7) [UniParc]FASTAAdd to basket
Also known as: NDF22

The sequence of this isoform differs from the canonical sequence as follows:
     231-256: Missing.

Show »
Length:636
Mass (Da):70,123
Checksum:i995A0710F6F48763
GO
Isoform Beta3 (identifier: P43322-8) [UniParc]FASTAAdd to basket
Also known as: NDF4

The sequence of this isoform differs from the canonical sequence as follows:
     231-241: MTSRRKRQETE → STSTPFLSLPE
     242-662: Missing.

Show »
Length:241
Mass (Da):26,213
Checksum:i556F9540DD94B32B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2K3Q3A0A0G2K3Q3_RAT
Neuregulin 1, isoform CRA_b
Nrg1 rCG_43164
700Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V7F0G3V7F0_RAT
Neuregulin 1, isoform CRA_e
Nrg1 rCG_43164
662Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3ZC94D3ZC94_RAT
Pro-neuregulin-1, membrane-bound is...
Nrg1
602Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V9Q0G3V9Q0_RAT
Neuregulin 1, isoform CRA_c
Nrg1 rCG_43164
644Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D4ACB2D4ACB2_RAT
Neuregulin 1, isoform CRA_i
Nrg1 rCG_43164
636Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V7D6G3V7D6_RAT
Pro-neuregulin-1, membrane-bound is...
Nrg1
517Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2K057A0A0G2K057_RAT
Neuregulin 1, isoform CRA_f
Nrg1 rCG_43164
695Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti90K → N AA sequence (PubMed:1349853).Curated1
Sequence conflicti137T → I AA sequence (PubMed:1349853).Curated1
Sequence conflicti208Y → S AA sequence (PubMed:1349853).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003436213 – 256PNEFT…LVKES → QPGFTGARCTENVPMKVQTQ E in isoform Alpha2A, isoform Alpha2B and isoform Alpha2C. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_003437231 – 257MTSRR…VKESK → KHLGIEFME in isoform Beta1. CuratedAdd BLAST27
Alternative sequenceiVSP_003440231 – 256Missing in isoform Beta2 and isoform BetA2A. CuratedAdd BLAST26
Alternative sequenceiVSP_003438231 – 241MTSRRKRQETE → STSTPFLSLPE in isoform Beta3. CuratedAdd BLAST11
Alternative sequenceiVSP_003439242 – 662Missing in isoform Beta3. CuratedAdd BLAST421
Alternative sequenceiVSP_003441325 – 330PPENVQ → RVRTRG in isoform Beta2. Curated6
Alternative sequenceiVSP_003442446 – 662Missing in isoform Alpha2C. 1 PublicationAdd BLAST217
Alternative sequenceiVSP_003443446 – 484YVSAM…SMTVS → HNLIAELRRNKAYRSKCMQI QLSATHLRPSSITHLGFIL in isoform Alpha2B. CuratedAdd BLAST39
Alternative sequenceiVSP_003444485 – 662Missing in isoform Alpha2B. CuratedAdd BLAST178

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U02315 mRNA Translation: AAA19940.1
U02316 mRNA Translation: AAA19941.1
U02317 mRNA Translation: AAA19942.1
U02318 mRNA Translation: AAA19943.1
U02319 mRNA Translation: AAA19944.1
U02320 mRNA Translation: AAA19945.1
U02321 mRNA Translation: AAA19946.1
U02322 mRNA Translation: AAA19947.1
U02323 mRNA Translation: AAA19948.1
U02324 mRNA Translation: AAA19949.1
M92430 mRNA No translation available.

Protein sequence database of the Protein Information Resource

More...
PIRi
I61718
I61719
I61722

NCBI Reference Sequences

More...
RefSeqi
NP_001258052.1, NM_001271123.1 [P43322-8]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Rn.37438

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
112400

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:112400

UCSC genome browser

More...
UCSCi
RGD:621341 rat [P43322-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U02315 mRNA Translation: AAA19940.1
U02316 mRNA Translation: AAA19941.1
U02317 mRNA Translation: AAA19942.1
U02318 mRNA Translation: AAA19943.1
U02319 mRNA Translation: AAA19944.1
U02320 mRNA Translation: AAA19945.1
U02321 mRNA Translation: AAA19946.1
U02322 mRNA Translation: AAA19947.1
U02323 mRNA Translation: AAA19948.1
U02324 mRNA Translation: AAA19949.1
M92430 mRNA No translation available.
PIRiI61718
I61719
I61722
RefSeqiNP_001258052.1, NM_001271123.1 [P43322-8]
UniGeneiRn.37438

3D structure databases

ProteinModelPortaliP43322
SMRiP43322
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000014268

PTM databases

iPTMnetiP43322
PhosphoSitePlusiP43322

Proteomic databases

PaxDbiP43322
PRIDEiP43322

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi112400
KEGGirno:112400
UCSCiRGD:621341 rat [P43322-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3084
RGDi621341 Nrg1

Phylogenomic databases

eggNOGiENOG410IEU9 Eukaryota
ENOG4110ST7 LUCA
HOVERGENiHBG006531
InParanoidiP43322
KOiK05455
PhylomeDBiP43322

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P43322

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040180 Neuregulin
IPR002154 Neuregulin_C
IPR018250 NRG1
PANTHERiPTHR11100 PTHR11100, 1 hit
PTHR11100:SF7 PTHR11100:SF7, 1 hit
PfamiView protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit
PRINTSiPR01089 NEUREGULIN
SMARTiView protein in SMART
SM00181 EGF, 1 hit
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRG1_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P43322
Secondary accession number(s): P43323
, P43324, P43325, P43326, P43327, P43328
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again