Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell surface glycoprotein MUC18

Gene

MCAM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.2 Publications

GO - Biological processi

  • anatomical structure morphogenesis Source: ProtInc
  • angiogenesis Source: MGI
  • cell adhesion Source: ProtInc
  • glomerular filtration Source: UniProtKB
  • positive regulation of cell migration Source: Ensembl
  • vascular wound healing Source: UniProtKB

Keywordsi

Biological processCell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Cell surface glycoprotein MUC18
Alternative name(s):
Cell surface glycoprotein P1H12
Melanoma cell adhesion molecule
Melanoma-associated antigen A32
Melanoma-associated antigen MUC18
S-endo 1 endothelial-associated antigen
CD_antigen: CD146
Gene namesi
Name:MCAM
Synonyms:MUC18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000076706.14
HGNCiHGNC:6934 MCAM
MIMi155735 gene
neXtProtiNX_P43121

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 559ExtracellularSequence analysisAdd BLAST536
Transmembranei560 – 583HelicalSequence analysisAdd BLAST24
Topological domaini584 – 646CytoplasmicSequence analysisAdd BLAST63

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4162
OpenTargetsiENSG00000076706
PharmGKBiPA30678

Chemistry databases

ChEMBLiCHEMBL3712863
GuidetoPHARMACOLOGYi2988

Polymorphism and mutation databases

BioMutaiMCAM
DMDMi85681878

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 231 PublicationAdd BLAST23
ChainiPRO_000001489124 – 646Cell surface glycoprotein MUC18Add BLAST623

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi48 ↔ 116Curated
Glycosylationi56N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi161 ↔ 223Curated
Disulfide bondi272 ↔ 320Curated
Disulfide bondi365 ↔ 407Curated
Glycosylationi418N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi449N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi452 ↔ 499Curated
Glycosylationi467N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi508N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi518N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi527N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi544N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei606PhosphoserineBy similarity1
Modified residuei614PhosphoserineCombined sources1
Modified residuei628PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiP43121
MaxQBiP43121
PaxDbiP43121
PeptideAtlasiP43121
PRIDEiP43121
ProteomicsDBi55589
55590 [P43121-2]

PTM databases

GlyConnecti1104
iPTMnetiP43121
PhosphoSitePlusiP43121
SwissPalmiP43121

Expressioni

Tissue specificityi

Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis.

Gene expression databases

BgeeiENSG00000076706 Expressed in 231 organ(s), highest expression level in popliteal artery
CleanExiHS_MCAM
ExpressionAtlasiP43121 baseline and differential
GenevisibleiP43121 HS

Organism-specific databases

HPAiCAB002147
HPA008848

Interactioni

Protein-protein interaction databases

BioGridi110332, 15 interactors
DIPiDIP-52791N
IntActiP43121, 8 interactors
MINTiP43121
STRINGi9606.ENSP00000264036

Structurei

3D structure databases

ProteinModelPortaliP43121
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 129Ig-like V-type 1Add BLAST106
Domaini139 – 242Ig-like V-type 2Add BLAST104
Domaini244 – 330Ig-like C2-type 1Add BLAST87
Domaini335 – 424Ig-like C2-type 2Add BLAST90
Domaini430 – 510Ig-like C2-type 3Add BLAST81

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEC2 Eukaryota
ENOG4110RPG LUCA
GeneTreeiENSGT00530000063457
HOGENOMiHOG000015427
HOVERGENiHBG002808
InParanoidiP43121
KOiK06534
OMAiGDQGEKY
OrthoDBiEOG091G072E
PhylomeDBiP43121
TreeFamiTF330534

Family and domain databases

Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR013162 CD80_C2-set
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR013151 Immunoglobulin
PfamiView protein in Pfam
PF08205 C2-set_2, 1 hit
PF00047 ig, 1 hit
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 5 hits
SM00408 IGc2, 3 hits
SUPFAMiSSF48726 SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 5 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P43121-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLPRLVCAF LLAACCCCPR VAGVPGEAEQ PAPELVEVEV GSTALLKCGL
60 70 80 90 100
SQSQGNLSHV DWFSVHKEKR TLIFRVRQGQ GQSEPGEYEQ RLSLQDRGAT
110 120 130 140 150
LALTQVTPQD ERIFLCQGKR PRSQEYRIQL RVYKAPEEPN IQVNPLGIPV
160 170 180 190 200
NSKEPEEVAT CVGRNGYPIP QVIWYKNGRP LKEEKNRVHI QSSQTVESSG
210 220 230 240 250
LYTLQSILKA QLVKEDKDAQ FYCELNYRLP SGNHMKESRE VTVPVFYPTE
260 270 280 290 300
KVWLEVEPVG MLKEGDRVEI RCLADGNPPP HFSISKQNPS TREAEEETTN
310 320 330 340 350
DNGVLVLEPA RKEHSGRYEC QGLDLDTMIS LLSEPQELLV NYVSDVRVSP
360 370 380 390 400
AAPERQEGSS LTLTCEAESS QDLEFQWLRE ETGQVLERGP VLQLHDLKRE
410 420 430 440 450
AGGGYRCVAS VPSIPGLNRT QLVNVAIFGP PWMAFKERKV WVKENMVLNL
460 470 480 490 500
SCEASGHPRP TISWNVNGTA SEQDQDPQRV LSTLNVLVTP ELLETGVECT
510 520 530 540 550
ASNDLGKNTS ILFLELVNLT TLTPDSNTTT GLSTSTASPH TRANSTSTER
560 570 580 590 600
KLPEPESRGV VIVAVIVCIL VLAVLGAVLY FLYKKGKLPC RRSGKQEITL
610 620 630 640
PPSRKSELVV EVKSDKLPEE MGLLQGSSGD KRAPGDQGEK YIDLRH
Length:646
Mass (Da):71,607
Last modified:January 10, 2006 - v2
Checksum:iE46CB8AC7BA0738E
GO
Isoform 2 (identifier: P43121-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: MGLPRLVCAF...GRPLKEEKNR → MVYIVRQFLL...SLPPLPPCPG
     549-646: ERKLPEPESR...QGEKYIDLRH → GKPGLAREQGCARASFLPCPSPESPVQKGE

Note: No experimental confirmation available.
Show »
Length:527
Mass (Da):57,605
Checksum:i68F5C36C5FFD36D6
GO

Sequence cautioni

The sequence BAD93162 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti322 – 324GLD → AWN (PubMed:2602381).Curated3
Sequence conflicti322 – 324GLD → AWN (PubMed:8378324).Curated3
Sequence conflicti383G → D (PubMed:2602381).Curated1
Sequence conflicti383G → D (PubMed:8378324).Curated1
Sequence conflicti383G → D (PubMed:11709656).Curated1
Sequence conflicti424 – 425NV → KL (PubMed:2602381).Curated2
Sequence conflicti424 – 425NV → KL (PubMed:8378324).Curated2
Sequence conflicti606S → T (PubMed:2602381).Curated1
Sequence conflicti606S → T (PubMed:8378324).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04991589E → G1 PublicationCorresponds to variant dbSNP:rs34587557Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0169381 – 187MGLPR…EEKNR → MVYIVRQFLLYNVSGSVYLD QLIVLLTAKFSILRIAGSRV HHSPFSGHLDGCSFLSLQHS LHTSLDMSRHENVFLGLTLS SKSAGLKGFQLAFVPGLLQG TGGYLDGPLPTPVDNPRVGL EVGLRLSLPPLPPCPG in isoform 2. 1 PublicationAdd BLAST187
Alternative sequenceiVSP_016939549 – 646ERKLP…IDLRH → GKPGLAREQGCARASFLPCP SPESPVQKGE in isoform 2. 1 PublicationAdd BLAST98

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29277 mRNA Translation: AAA20824.1
M28882 mRNA Translation: AAA20922.1
X68264
, X68265, X68266, X68267, X68268, X68270, X68271 Genomic DNA Translation: CAA48332.1
AF089868 mRNA Translation: AAD17799.1
AK126303 mRNA Translation: BAC86520.1
AB209925 mRNA Translation: BAD93162.1 Different initiation.
BC056418 mRNA Translation: AAH56418.1
CCDSiCCDS31690.1 [P43121-1]
PIRiI38049
RefSeqiNP_006491.2, NM_006500.2 [P43121-1]
UniGeneiHs.599039

Genome annotation databases

EnsembliENST00000264036; ENSP00000264036; ENSG00000076706 [P43121-1]
GeneIDi4162
KEGGihsa:4162
UCSCiuc001pwf.4 human [P43121-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29277 mRNA Translation: AAA20824.1
M28882 mRNA Translation: AAA20922.1
X68264
, X68265, X68266, X68267, X68268, X68270, X68271 Genomic DNA Translation: CAA48332.1
AF089868 mRNA Translation: AAD17799.1
AK126303 mRNA Translation: BAC86520.1
AB209925 mRNA Translation: BAD93162.1 Different initiation.
BC056418 mRNA Translation: AAH56418.1
CCDSiCCDS31690.1 [P43121-1]
PIRiI38049
RefSeqiNP_006491.2, NM_006500.2 [P43121-1]
UniGeneiHs.599039

3D structure databases

ProteinModelPortaliP43121
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110332, 15 interactors
DIPiDIP-52791N
IntActiP43121, 8 interactors
MINTiP43121
STRINGi9606.ENSP00000264036

Chemistry databases

ChEMBLiCHEMBL3712863
GuidetoPHARMACOLOGYi2988

PTM databases

GlyConnecti1104
iPTMnetiP43121
PhosphoSitePlusiP43121
SwissPalmiP43121

Polymorphism and mutation databases

BioMutaiMCAM
DMDMi85681878

Proteomic databases

EPDiP43121
MaxQBiP43121
PaxDbiP43121
PeptideAtlasiP43121
PRIDEiP43121
ProteomicsDBi55589
55590 [P43121-2]

Protocols and materials databases

DNASUi4162
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264036; ENSP00000264036; ENSG00000076706 [P43121-1]
GeneIDi4162
KEGGihsa:4162
UCSCiuc001pwf.4 human [P43121-1]

Organism-specific databases

CTDi4162
DisGeNETi4162
EuPathDBiHostDB:ENSG00000076706.14
GeneCardsiMCAM
HGNCiHGNC:6934 MCAM
HPAiCAB002147
HPA008848
MIMi155735 gene
neXtProtiNX_P43121
OpenTargetsiENSG00000076706
PharmGKBiPA30678
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEC2 Eukaryota
ENOG4110RPG LUCA
GeneTreeiENSGT00530000063457
HOGENOMiHOG000015427
HOVERGENiHBG002808
InParanoidiP43121
KOiK06534
OMAiGDQGEKY
OrthoDBiEOG091G072E
PhylomeDBiP43121
TreeFamiTF330534

Miscellaneous databases

ChiTaRSiMCAM human
GeneWikiiCD146
GenomeRNAii4162
PROiPR:P43121
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000076706 Expressed in 231 organ(s), highest expression level in popliteal artery
CleanExiHS_MCAM
ExpressionAtlasiP43121 baseline and differential
GenevisibleiP43121 HS

Family and domain databases

Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR013162 CD80_C2-set
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR013151 Immunoglobulin
PfamiView protein in Pfam
PF08205 C2-set_2, 1 hit
PF00047 ig, 1 hit
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 5 hits
SM00408 IGc2, 3 hits
SUPFAMiSSF48726 SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 5 hits
ProtoNetiSearch...

Entry informationi

Entry nameiMUC18_HUMAN
AccessioniPrimary (citable) accession number: P43121
Secondary accession number(s): O95812
, Q59E86, Q6PHR3, Q6ZTR2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: January 10, 2006
Last modified: October 10, 2018
This is version 168 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again