Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P43121 (MUC18_HUMAN)

Entry version 191 (25 May 2022)
Sequence version 2 (10 Jan 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Cell surface glycoprotein MUC18

Gene

MCAM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P43121

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8980692, RHOA GTPase cycle
R-HSA-9013026, RHOB GTPase cycle
R-HSA-9013106, RHOC GTPase cycle
R-HSA-9013149, RAC1 GTPase cycle
R-HSA-9013404, RAC2 GTPase cycle
R-HSA-9013405, RHOD GTPase cycle
R-HSA-9013408, RHOG GTPase cycle
R-HSA-9013423, RAC3 GTPase cycle
R-HSA-9035034, RHOF GTPase cycle

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P43121

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cell surface glycoprotein MUC18
Alternative name(s):
Cell surface glycoprotein P1H12
Melanoma cell adhesion molecule
Melanoma-associated antigen A32
Melanoma-associated antigen MUC18
S-endo 1 endothelial-associated antigen
CD_antigen: CD146
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MCAM
Synonyms:MUC18
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6934, MCAM

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		155735, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P43121

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000076706

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 559ExtracellularSequence analysisAdd BLAST536
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei560 – 583HelicalSequence analysisAdd BLAST24
Topological domaini584 – 646CytoplasmicSequence analysisAdd BLAST63

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		4162

Open Targets

More...OpenTargetsi		ENSG00000076706

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30678

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P43121, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3712863

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		2988

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MCAM

Domain mapping of disease mutations (DMDM)

More...DMDMi		85681878

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 231 PublicationAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001489124 – 646Cell surface glycoprotein MUC18Add BLAST623

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi48 ↔ 116Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi56N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi161 ↔ 223Curated
Disulfide bondi272 ↔ 320Curated
Disulfide bondi365 ↔ 407Curated
Glycosylationi418N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi449N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi452 ↔ 499Curated
Glycosylationi467N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi508N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi518N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi527N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi544N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei606PhosphoserineBy similarity1
Modified residuei614PhosphoserineCombined sources1
Modified residuei628PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P43121

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P43121

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P43121

MaxQB - The MaxQuant DataBase

More...MaxQBi		P43121

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P43121

PeptideAtlas

More...PeptideAtlasi		P43121

PRoteomics IDEntifications database

More...PRIDEi		P43121

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55589 [P43121-1]
55590 [P43121-2]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1104, 2 N-Linked glycans (2 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P43121, 9 sites, 1 N-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P43121

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P43121

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P43121

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000076706, Expressed in popliteal artery and 242 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P43121, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P43121, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000076706, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110332, 67 interactors

Database of interacting proteins

More...DIPi		DIP-52791N

Protein interaction database and analysis system

More...IntActi		P43121, 27 interactors

Molecular INTeraction database

More...MINTi		P43121

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000264036

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P43121, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1646
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		P43121

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P43121

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 129Ig-like V-type 1Add BLAST106
Domaini139 – 242Ig-like V-type 2Add BLAST104
Domaini244 – 330Ig-like C2-type 1Add BLAST87
Domaini335 – 424Ig-like C2-type 2Add BLAST90
Domaini430 – 510Ig-like C2-type 3Add BLAST81

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni278 – 299DisorderedSequence analysisAdd BLAST22
Regioni525 – 554DisorderedSequence analysisAdd BLAST30
Regioni620 – 646DisorderedSequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi525 – 546Polar residuesSequence analysisAdd BLAST22

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QV1U, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155838

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_028888_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P43121

Identification of Orthologs from Complete Genome Data

More...OMAi		RCMASVP

Database for complete collections of gene phylogenies

More...PhylomeDBi		P43121

TreeFam database of animal gene trees

More...TreeFami		TF330534

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013162, CD80_C2-set
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR013151, Immunoglobulin

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08205, C2-set_2, 1 hit
PF00047, ig, 1 hit
PF07686, V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409, IG, 5 hits
SM00408, IGc2, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 5 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P43121-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLPRLVCAF LLAACCCCPR VAGVPGEAEQ PAPELVEVEV GSTALLKCGL 
        60         70         80         90        100
SQSQGNLSHV DWFSVHKEKR TLIFRVRQGQ GQSEPGEYEQ RLSLQDRGAT 
       110        120        130        140        150
LALTQVTPQD ERIFLCQGKR PRSQEYRIQL RVYKAPEEPN IQVNPLGIPV 
       160        170        180        190        200
NSKEPEEVAT CVGRNGYPIP QVIWYKNGRP LKEEKNRVHI QSSQTVESSG 
       210        220        230        240        250
LYTLQSILKA QLVKEDKDAQ FYCELNYRLP SGNHMKESRE VTVPVFYPTE 
       260        270        280        290        300
KVWLEVEPVG MLKEGDRVEI RCLADGNPPP HFSISKQNPS TREAEEETTN 
       310        320        330        340        350
DNGVLVLEPA RKEHSGRYEC QGLDLDTMIS LLSEPQELLV NYVSDVRVSP 
       360        370        380        390        400
AAPERQEGSS LTLTCEAESS QDLEFQWLRE ETGQVLERGP VLQLHDLKRE 
       410        420        430        440        450
AGGGYRCVAS VPSIPGLNRT QLVNVAIFGP PWMAFKERKV WVKENMVLNL 
       460        470        480        490        500
SCEASGHPRP TISWNVNGTA SEQDQDPQRV LSTLNVLVTP ELLETGVECT 
       510        520        530        540        550
ASNDLGKNTS ILFLELVNLT TLTPDSNTTT GLSTSTASPH TRANSTSTER 
       560        570        580        590        600
KLPEPESRGV VIVAVIVCIL VLAVLGAVLY FLYKKGKLPC RRSGKQEITL 
       610        620        630        640 
PPSRKSELVV EVKSDKLPEE MGLLQGSSGD KRAPGDQGEK YIDLRH
Length:646
Mass (Da):71,607
Last modified:January 10, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE46CB8AC7BA0738E
GO
Isoform 2 (identifier: P43121-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: MGLPRLVCAF...GRPLKEEKNR → MVYIVRQFLL...SLPPLPPCPG
     549-646: ERKLPEPESR...QGEKYIDLRH → GKPGLAREQGCARASFLPCPSPESPVQKGE

Show »
Length:527
Mass (Da):57,605
Checksum:i68F5C36C5FFD36D6
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD93162 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti322 – 324GLD → AWN (PubMed:2602381).Curated3
Sequence conflicti322 – 324GLD → AWN (PubMed:8378324).Curated3
Sequence conflicti383G → D (PubMed:2602381).Curated1
Sequence conflicti383G → D (PubMed:8378324).Curated1
Sequence conflicti383G → D (PubMed:11709656).Curated1
Sequence conflicti424 – 425NV → KL (PubMed:2602381).Curated2
Sequence conflicti424 – 425NV → KL (PubMed:8378324).Curated2
Sequence conflicti606S → T (PubMed:2602381).Curated1
Sequence conflicti606S → T (PubMed:8378324).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04991589E → G1 PublicationCorresponds to variant dbSNP:rs34587557Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0169381 – 187MGLPR…EEKNR → MVYIVRQFLLYNVSGSVYLD QLIVLLTAKFSILRIAGSRV HHSPFSGHLDGCSFLSLQHS LHTSLDMSRHENVFLGLTLS SKSAGLKGFQLAFVPGLLQG TGGYLDGPLPTPVDNPRVGL EVGLRLSLPPLPPCPG in isoform 2. 1 PublicationAdd BLAST187
Alternative sequenceiVSP_016939549 – 646ERKLP…IDLRH → GKPGLAREQGCARASFLPCP SPESPVQKGE in isoform 2. 1 PublicationAdd BLAST98

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M29277 mRNA Translation: AAA20824.1
M28882 mRNA Translation: AAA20922.1
X68264 X68271 Genomic DNA Translation: CAA48332.1
AF089868 mRNA Translation: AAD17799.1
AK126303 mRNA Translation: BAC86520.1
AB209925 mRNA Translation: BAD93162.1 Different initiation.
BC056418 mRNA Translation: AAH56418.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31690.1 [P43121-1]

Protein sequence database of the Protein Information Resource

More...PIRi		I38049

NCBI Reference Sequences

More...RefSeqi		NP_006491.2, NM_006500.2 [P43121-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000264036.6; ENSP00000264036.4; ENSG00000076706.17

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4162

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4162

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000264036.6; ENSP00000264036.4; NM_006500.3; NP_006491.2

UCSC genome browser

More...UCSCi		uc001pwf.4, human [P43121-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29277 mRNA Translation: AAA20824.1
M28882 mRNA Translation: AAA20922.1
X68264 X68271 Genomic DNA Translation: CAA48332.1
AF089868 mRNA Translation: AAD17799.1
AK126303 mRNA Translation: BAC86520.1
AB209925 mRNA Translation: BAD93162.1 Different initiation.
BC056418 mRNA Translation: AAH56418.1
CCDSiCCDS31690.1 [P43121-1]
PIRiI38049
RefSeqiNP_006491.2, NM_006500.2 [P43121-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6LYNX-ray2.78C/D336-519[»]
AlphaFoldDBiP43121
SMRiP43121
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110332, 67 interactors
DIPiDIP-52791N
IntActiP43121, 27 interactors
MINTiP43121
STRINGi9606.ENSP00000264036

Chemistry databases

ChEMBLiCHEMBL3712863
GuidetoPHARMACOLOGYi2988

PTM databases

GlyConnecti1104, 2 N-Linked glycans (2 sites)
GlyGeniP43121, 9 sites, 1 N-linked glycan (1 site)
iPTMnetiP43121
PhosphoSitePlusiP43121
SwissPalmiP43121

Genetic variation databases

BioMutaiMCAM
DMDMi85681878

Proteomic databases

EPDiP43121
jPOSTiP43121
MassIVEiP43121
MaxQBiP43121
PaxDbiP43121
PeptideAtlasiP43121
PRIDEiP43121
ProteomicsDBi55589 [P43121-1]
55590 [P43121-2]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P43121, 2 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2244, 2057 antibodies from 47 providers

The DNASU plasmid repository

More...DNASUi		4162

Genome annotation databases

EnsembliENST00000264036.6; ENSP00000264036.4; ENSG00000076706.17
GeneIDi4162
KEGGihsa:4162
MANE-SelectiENST00000264036.6; ENSP00000264036.4; NM_006500.3; NP_006491.2
UCSCiuc001pwf.4, human [P43121-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4162
DisGeNETi4162

GeneCards: human genes, protein and diseases

More...GeneCardsi		MCAM
HGNCiHGNC:6934, MCAM
HPAiENSG00000076706, Low tissue specificity
MIMi155735, gene
neXtProtiNX_P43121
OpenTargetsiENSG00000076706
PharmGKBiPA30678
VEuPathDBiHostDB:ENSG00000076706

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QV1U, Eukaryota
GeneTreeiENSGT00940000155838
HOGENOMiCLU_028888_3_0_1
InParanoidiP43121
OMAiRCMASVP
PhylomeDBiP43121
TreeFamiTF330534

Enzyme and pathway databases

PathwayCommonsiP43121
ReactomeiR-HSA-8980692, RHOA GTPase cycle
R-HSA-9013026, RHOB GTPase cycle
R-HSA-9013106, RHOC GTPase cycle
R-HSA-9013149, RAC1 GTPase cycle
R-HSA-9013404, RAC2 GTPase cycle
R-HSA-9013405, RHOD GTPase cycle
R-HSA-9013408, RHOG GTPase cycle
R-HSA-9013423, RAC3 GTPase cycle
R-HSA-9035034, RHOF GTPase cycle
SignaLinkiP43121

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4162, 10 hits in 1082 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MCAM, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CD146

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4162
PharosiP43121, Tbio

Protein Ontology

More...PROi		PR:P43121
RNActiP43121, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000076706, Expressed in popliteal artery and 242 other tissues
ExpressionAtlasiP43121, baseline and differential
GenevisibleiP43121, HS

Family and domain databases

Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR013162, CD80_C2-set
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR013151, Immunoglobulin
PfamiView protein in Pfam
PF08205, C2-set_2, 1 hit
PF00047, ig, 1 hit
PF07686, V-set, 1 hit
SMARTiView protein in SMART
SM00409, IG, 5 hits
SM00408, IGc2, 3 hits
SUPFAMiSSF48726, SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 5 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMUC18_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P43121
Secondary accession number(s): O95812
, Q59E86, Q6PHR3, Q6ZTR2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: January 10, 2006
Last modified: May 25, 2022
This is version 191 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again