Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin E2 receptor EP3 subtype

Gene

PTGER3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-391908 Prostanoid ligand receptors
R-HSA-418594 G alpha (i) signalling events
SIGNORiP43115

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
PGE2-R
Prostanoid EP3 receptor
Gene namesi
Name:PTGER3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000050628.20
HGNCiHGNC:9595 PTGER3
MIMi176806 gene
neXtProtiNX_P43115

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 53ExtracellularSequence analysisAdd BLAST53
Transmembranei54 – 78Helical; Name=1Sequence analysisAdd BLAST25
Topological domaini79 – 91CytoplasmicSequence analysisAdd BLAST13
Transmembranei92 – 112Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini113 – 131ExtracellularSequence analysisAdd BLAST19
Transmembranei132 – 153Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini154 – 175CytoplasmicSequence analysisAdd BLAST22
Transmembranei176 – 197Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini198 – 227ExtracellularSequence analysisAdd BLAST30
Transmembranei228 – 253Helical; Name=5Sequence analysisAdd BLAST26
Topological domaini254 – 283CytoplasmicSequence analysisAdd BLAST30
Transmembranei284 – 307Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini308 – 327ExtracellularSequence analysisAdd BLAST20
Transmembranei328 – 349Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini350 – 390CytoplasmicSequence analysisAdd BLAST41

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5733
OpenTargetsiENSG00000050628
PharmGKBiPA288

Chemistry databases

ChEMBLiCHEMBL3710
DrugBankiDB00905 Bimatoprost
DB00917 Dinoprostone
DB00929 Misoprostol
GuidetoPHARMACOLOGYi342

Polymorphism and mutation databases

BioMutaiPTGER3
DMDMi1172071

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000700581 – 390Prostaglandin E2 receptor EP3 subtypeAdd BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi18N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP43115
PRIDEiP43115
ProteomicsDBi55580
55581 [P43115-2]
55582 [P43115-3]
55583 [P43115-4]
55584 [P43115-5]
55585 [P43115-6]
55586 [P43115-7]

PTM databases

iPTMnetiP43115
PhosphoSitePlusiP43115

Expressioni

Tissue specificityi

Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.1 Publication

Gene expression databases

BgeeiENSG00000050628
CleanExiHS_PTGER3
ExpressionAtlasiP43115 baseline and differential
GenevisibleiP43115 HS

Organism-specific databases

HPAiHPA010689

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi111705, 112 interactors
IntActiP43115, 18 interactors
STRINGi9606.ENSP00000349003

Chemistry databases

BindingDBiP43115

Structurei

3D structure databases

ProteinModelPortaliP43115
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00760000119188
HOGENOMiHOG000015238
HOVERGENiHBG052720
InParanoidiP43115
KOiK04260
OMAiFPITMLI
OrthoDBiEOG091G09H9
PhylomeDBiP43115
TreeFamiTF324982

Family and domain databases

InterProiView protein in InterPro
IPR001481 EP3_rcpt_2
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR008365 Prostanoid_rcpt
IPR001244 Prostglndn_DP_rcpt
IPR000265 Prostglndn_EP3_rcpt
PANTHERiPTHR11866 PTHR11866, 1 hit
PTHR11866:SF10 PTHR11866:SF10, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR00428 PROSTAGLNDNR
PR01788 PROSTANOIDR
PR00584 PRSTNOIDE32R
PR00582 PRSTNOIDEP3R
PROSITEiView protein in PROSITE
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform EP3A (identifier: P43115-1) [UniParc]FASTAAdd to basket
Also known as: EP3-I, EP3a1, EP3a2, EP(3-Ic)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKETRGYGGD APFCTRLNHS YTGMWAPERS AEARGNLTRP PGSGEDCGSV
60 70 80 90 100
SVAFPITMLL TGFVGNALAM LLVSRSYRRR ESKRKKSFLL CIGWLALTDL
110 120 130 140 150
VGQLLTTPVV IVVYLSKQRW EHIDPSGRLC TFFGLTMTVF GLSSLFIASA
160 170 180 190 200
MAVERALAIR APHWYASHMK TRATRAVLLG VWLAVLAFAL LPVLGVGQYT
210 220 230 240 250
VQWPGTWCFI STGRGGNGTS SSHNWGNLFF ASAFAFLGLL ALTVTFSCNL
260 270 280 290 300
ATIKALVSRC RAKATASQSS AQWGRITTET AIQLMGIMCV LSVCWSPLLI
310 320 330 340 350
MMLKMIFNQT SVEHCKTHTE KQKECNFFLI AVRLASLNQI LDPWVYLLLR
360 370 380 390
KILLRKFCQI RYHTNNYASS STSLPCQCSS TLMWSDHLER
Length:390
Mass (Da):43,310
Last modified:November 1, 1995 - v1
Checksum:iBC76EAC78FDF5420
GO
Isoform EP3C (identifier: P43115-2) [UniParc]FASTAAdd to basket
Also known as: EP3-II

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEA

Note: Known as EP3D in PubMed:8075855.
Show »
Length:388
Mass (Da):42,682
Checksum:i96ED050A946BDC5F
GO
Isoform EP3B (identifier: P43115-3) [UniParc]FASTAAdd to basket
Also known as: EP3-III

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EEFWGN

Note: Known as EP3E in PubMed:8075855.
Show »
Length:365
Mass (Da):40,502
Checksum:i1AA2E95EB596EB46
GO
Isoform EP3D (identifier: P43115-4) [UniParc]FASTAAdd to basket
Also known as: EP3-IV

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQEEFWGN

Note: Known as EP3F in PubMed:8075855.
Show »
Length:374
Mass (Da):41,756
Checksum:i431BF492DBA231DE
GO
Isoform EP3E (identifier: P43115-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQL...YTRISTVKTE

Show »
Length:418
Mass (Da):46,687
Checksum:i9FAA12E0E24405D3
GO
Isoform EP3F (identifier: P43115-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQA...LREPCSVQLS

Show »
Length:425
Mass (Da):47,332
Checksum:i65447F57530539F8
GO
Isoform EP3G (identifier: P43115-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EMGPDGRCFCHAWRQVPRTWCSSHDREPCSVQLS

Show »
Length:393
Mass (Da):43,683
Checksum:i3E9981F9C4389606
GO
Isoform EP3-III (identifier: P43115-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAEEFWGN

Show »
Length:394
Mass (Da):43,445
Checksum:i633646EC3F2576ED
GO
Isoform EP3-IV (identifier: P43115-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAMRKRRLREQEEFWGN

Show »
Length:403
Mass (Da):44,699
Checksum:i599101B5BD1426C7
GO
Isoform EP3-V (identifier: P43115-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...DREPCSVQLS

Show »
Length:431
Mass (Da):47,881
Checksum:i10C8E00EB53C1CEB
GO
Isoform EP3E2 (identifier: P43115-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...IVGKYKPIVC

Show »
Length:422
Mass (Da):46,849
Checksum:i0EAD22290C4C2B22
GO
Isoform 12 (identifier: P43115-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQF...QVILLPQPPK

Show »
Length:429
Mass (Da):47,736
Checksum:i1CC39D17C3FE5FF7
GO

Sequence cautioni

The sequence CAA58742 differs from that shown. Reason: Frameshift at position 374.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28 – 29ER → DG (PubMed:8117308).Curated2
Sequence conflicti28 – 29ER → DG (PubMed:8135729).Curated2
Sequence conflicti28 – 29ER → DG (PubMed:8075855).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_014694169M → L. Corresponds to variant dbSNP:rs5670Ensembl.1
Natural variantiVAR_049436319T → M. Corresponds to variant dbSNP:rs13306020Ensembl.1
Natural variantiVAR_029218366N → S. Corresponds to variant dbSNP:rs13306014Ensembl.1
Natural variantiVAR_014695375P → L. Corresponds to variant dbSNP:rs5694Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_058943360 – 390IRYHT…DHLER → MRKRRLREQFWRPASSGSGC QQIRCLMESCSLTQTGVQWS DFRSLQPSPPPLTAIFASWV QVILLPQPPK in isoform 12. Add BLAST31
Alternative sequenceiVSP_053774360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAEEFWGN in isoform EP3-III. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_053775360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEE FWGN in isoform EP3-IV. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_053776360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEM GPDGRCFCHAWRQVPRTWCS SHDREPCSVQLS in isoform EP3-V. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_001936360 – 390IRYHT…DHLER → EEFWGN in isoform EP3B. 7 PublicationsAdd BLAST31
Alternative sequenceiVSP_001935360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEA in isoform EP3C. 6 PublicationsAdd BLAST31
Alternative sequenceiVSP_001937360 – 390IRYHT…DHLER → MRKRRLREQEEFWGN in isoform EP3D. 6 PublicationsAdd BLAST31
Alternative sequenceiVSP_001938360 – 390IRYHT…DHLER → MRKRRLREQLICSLQNSQIQ RATAHCGQVQTYRVLNREEM EVLVSSINVYTRISTVKTE in isoform EP3E. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_053777360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQLI CSLRTLRYRGQLHIVGKYKP IVC in isoform EP3E2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_001939360 – 390IRYHT…DHLER → MRKRRLREQAPLLPTPTVID PSRFCAQPFRWFLDLSFPAM SSSHPQLPLTLASFKLLREP CSVQLS in isoform EP3F. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_013271360 – 390IRYHT…DHLER → EMGPDGRCFCHAWRQVPRTW CSSHDREPCSVQLS in isoform EP3G. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S69200 mRNA Translation: AAB29854.1
L27488 mRNA Translation: AAC13372.1
L27489 mRNA Translation: AAC13373.1
L27490 mRNA Translation: AAC13374.1
X83857 mRNA Translation: CAA58737.1
X83858 mRNA Translation: CAA58738.1
X83859 mRNA Translation: CAA58739.1
X83860 mRNA Translation: CAA58740.1
X83861 mRNA Translation: CAA58741.1
X83862 mRNA Translation: CAA58742.1 Frameshift.
X83863 mRNA Translation: CAA58743.1
L26976 mRNA Translation: AAA60076.1
S69326 mRNA Translation: AAB30208.1
L32660 mRNA Translation: AAA68191.1
L32661 mRNA Translation: AAA68192.1
L32662 mRNA Translation: AAA68193.1
D38297 mRNA Translation: BAA07416.1
D38298 mRNA Translation: BAA07417.1
D38299 mRNA Translation: BAA07418.1
D38300 mRNA Translation: BAA07419.1
D38301 mRNA Translation: BAA07420.1
U13214 mRNA Translation: AAA21130.1
U13215 mRNA Translation: AAA21131.1
U13216 mRNA Translation: AAA21132.1
U13217 mRNA Translation: AAA21133.1
U13218 mRNA Translation: AAA21134.1
D86096 Genomic DNA Translation: BAA19951.1
D86096 Genomic DNA Translation: BAA19952.1
D86096 Genomic DNA Translation: BAA19953.1
D86096 Genomic DNA Translation: BAA19954.1
D86096 Genomic DNA Translation: BAA19956.1
D86096 Genomic DNA Translation: BAA19957.1
D86098 mRNA Translation: BAA19959.1
AY429108 mRNA Translation: AAR07903.1
AK315825 mRNA Translation: BAF98716.1
AB451481 mRNA Translation: BAG70295.1
AL031429 Genomic DNA No translation available.
AL158087 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06439.1
CH471059 Genomic DNA Translation: EAX06446.1
BC024229 mRNA Translation: AAH24229.1
BC118578 mRNA Translation: AAI18579.1
CCDSiCCDS44160.1 [P43115-3]
CCDS652.1 [P43115-4]
CCDS655.1 [P43115-5]
CCDS656.1 [P43115-1]
CCDS657.1 [P43115-1]
CCDS658.1 [P43115-2]
PIRiB55995
I38747
I38748
I38750
JC2056
S43375
S68994 S51313
S68995 S51315
S68996 S51316
S68997 S51317
S68998 S51318
S68999 S51319
RefSeqiNP_001119516.1, NM_001126044.1 [P43115-1]
NP_942007.1, NM_198714.1 [P43115-1]
NP_942008.1, NM_198715.2 [P43115-2]
NP_942009.1, NM_198716.1 [P43115-4]
NP_942010.1, NM_198717.1 [P43115-3]
NP_942011.1, NM_198718.1 [P43115-5]
NP_942012.1, NM_198719.1 [P43115-1]
UniGeneiHs.445000

Genome annotation databases

EnsembliENST00000306666; ENSP00000302313; ENSG00000050628 [P43115-1]
ENST00000351052; ENSP00000280208; ENSG00000050628 [P43115-1]
ENST00000356595; ENSP00000349003; ENSG00000050628 [P43115-5]
ENST00000370924; ENSP00000359962; ENSG00000050628 [P43115-2]
ENST00000370931; ENSP00000359969; ENSG00000050628 [P43115-1]
ENST00000460330; ENSP00000418073; ENSG00000050628 [P43115-4]
ENST00000479353; ENSP00000421583; ENSG00000050628 [P43115-7]
ENST00000628037; ENSP00000486617; ENSG00000050628 [P43115-3]
GeneIDi5733
KEGGihsa:5733
UCSCiuc001dfg.2 human [P43115-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPE2R3_HUMAN
AccessioniPrimary (citable) accession number: P43115
Secondary accession number(s): B0AZN4
, B1AK19, B5BUP5, O00326, Q12943, Q12944, Q12945, Q147X8, Q16546, Q5CZ59, Q5CZ61, Q5CZ62, Q5CZ63, Q5CZ64
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: July 18, 2018
This is version 179 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health