Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P43088 (PF2R_HUMAN)

Entry version 183 (29 Sep 2021)
Sequence version 1 (01 Nov 1995)
Previous versions | rss
Add a publicationFeedback
Protein

Prostaglandin F2-alpha receptor

Gene

PTGFR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum (By similarity).

Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost.

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P43088

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-391908, Prostanoid ligand receptors
R-HSA-416476, G alpha (q) signalling events

SIGNOR Signaling Network Open Resource

More...SIGNORi		P43088

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001573

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Prostaglandin F2-alpha receptor
Short name:
PGF receptor
Short name:
PGF2-alpha receptor
Alternative name(s):
Prostanoid FP receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTGFR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9600, PTGFR

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600563, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P43088

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000122420

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 31ExtracellularSequence analysisAdd BLAST31
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei32 – 54Helical; Name=1Sequence analysisAdd BLAST23
Topological domaini55 – 69CytoplasmicSequence analysisAdd BLAST15
Transmembranei70 – 90Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini91 – 109ExtracellularSequence analysisAdd BLAST19
Transmembranei110 – 131Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini132 – 152CytoplasmicSequence analysisAdd BLAST21
Transmembranei153 – 175Helical; Name=4Sequence analysisAdd BLAST23
Topological domaini176 – 198ExtracellularSequence analysisAdd BLAST23
Transmembranei199 – 224Helical; Name=5Sequence analysisAdd BLAST26
Topological domaini225 – 250CytoplasmicSequence analysisAdd BLAST26
Transmembranei251 – 267Helical; Name=6Sequence analysisAdd BLAST17
Topological domaini268 – 285ExtracellularSequence analysisAdd BLAST18
Transmembranei286 – 307Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini308 – 359CytoplasmicSequence analysisAdd BLAST52

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		5737

Open Targets

More...OpenTargetsi		ENSG00000122420

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA290

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P43088, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1987

Drug and drug target database

More...DrugBanki		DB00905, Bimatoprost
DB01160, Dinoprost tromethamine
DB00654, Latanoprost
DB11660, Latanoprostene bunod
DB08819, Tafluprost
DB00287, Travoprost

DrugCentral

More...DrugCentrali		P43088

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		344

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PTGFR

Domain mapping of disease mutations (DMDM)

More...DMDMi		1172442

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000700701 – 359Prostaglandin F2-alpha receptorAdd BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi4N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi19N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi108 ↔ 186PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P43088

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P43088

PeptideAtlas

More...PeptideAtlasi		P43088

PRoteomics IDEntifications database

More...PRIDEi		P43088

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55578 [P43088-1]
55579 [P43088-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P43088, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P43088

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P43088

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Eye.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000122420, Expressed in calcaneal tendon and 157 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P43088, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P43088, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000122420, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 1 can form heterodimers with isoform 5 (and probably other isoforms).

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111709, 14 interactors

Protein interaction database and analysis system

More...IntActi		P43088, 9 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000359793

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P43088

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P43088, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3656, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01030000234559

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_045991_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P43088

Identification of Orthologs from Complete Genome Data

More...OMAi		MICQLLA

Database of Orthologous Groups

More...OrthoDBi		972015at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P43088

TreeFam database of animal gene trees

More...TreeFami		TF324982

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM
IPR000141, PglndnF_rcpt
IPR008365, Prostanoid_rcpt

The PANTHER Classification System

More...PANTHERi		PTHR11866, PTHR11866, 1 hit
PTHR11866:SF4, PTHR11866:SF4, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001, 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00237, GPCRRHODOPSN
PR01788, PROSTANOIDR
PR00855, PRSTNOIDFPR

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P43088-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSMNNSKQLV SPAAALLSNT TCQTENRLSV FFSVIFMTVG ILSNSLAIAI 
        60         70         80         90        100
LMKAYQRFRQ KSKASFLLLA SGLVITDFFG HLINGAIAVF VYASDKEWIR 
       110        120        130        140        150
FDQSNVLCSI FGICMVFSGL CPLLLGSVMA IERCIGVTKP IFHSTKITSK 
       160        170        180        190        200
HVKMMLSGVC LFAVFIALLP ILGHRDYKIQ ASRTWCFYNT EDIKDWEDRF 
       210        220        230        240        250
YLLLFSFLGL LALGVSLLCN AITGITLLRV KFKSQQHRQG RSHHLEMVIQ 
       260        270        280        290        300
LLAIMCVSCI CWSPFLVTMA NIGINGNHSL ETCETTLFAL RMATWNQILD 
       310        320        330        340        350
PWVYILLRKA VLKNLYKLAS QCCGVHVISL HIWELSSIKN SLKVAAISES 

PVAEKSAST
Length:359
Mass (Da):40,055
Last modified:November 1, 1995 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i08077045C0B20BCA
GO
Isoform 2 (identifier: P43088-2) [UniParc]FASTAAdd to basket
Also known as: FP(S), VAR-1

The sequence of this isoform differs from the canonical sequence as follows:
     267-359: VTMANIGING...SPVAEKSAST → GYRIILNGKEKYKVYEEQSDFLHRLQWPTLE

Show »
Length:297
Mass (Da):33,653
Checksum:i1D8C7CF32EE59529
GO
Isoform 3 (identifier: P43088-3) [UniParc]FASTAAdd to basket
Also known as: VAR-2

The sequence of this isoform differs from the canonical sequence as follows:
     267-275: VTMANIGIN → KIEGKIKVT
     276-359: Missing.

Show »
Length:275
Mass (Da):30,814
Checksum:i7FB54BA16E7CD983
GO
Isoform 4 (identifier: P43088-4) [UniParc]FASTAAdd to basket
Also known as: VAR-3

The sequence of this isoform differs from the canonical sequence as follows:
     267-291: VTMANIGINGNHSLETCETTLFALR → GYRIILNGKEKYKVYEEQSDFLHRK
     292-359: Missing.

Show »
Length:291
Mass (Da):32,913
Checksum:i41395134EB1B0802
GO
Isoform 5 (identifier: P43088-5) [UniParc]FASTAAdd to basket
Also known as: altFP4, VAR-4

The sequence of this isoform differs from the canonical sequence as follows:
     268-296: TMANIGINGNHSLETCETTLFALRMATWN → KETHLQMRLWTWDFRVNALEDYCEGLTVF
     297-359: Missing.

Show »
Length:296
Mass (Da):33,500
Checksum:i449FB52BF889E7E2
GO
Isoform 6 (identifier: P43088-6) [UniParc]FASTAAdd to basket
Also known as: VAR-5

The sequence of this isoform differs from the canonical sequence as follows:
     267-267: V → R
     268-359: Missing.

Show »
Length:267
Mass (Da):29,973
Checksum:iFD9F12B730760373
GO
Isoform 7 (identifier: P43088-7) [UniParc]FASTAAdd to basket
Also known as: VAR-6

The sequence of this isoform differs from the canonical sequence as follows:
     267-274: VTMANIGI → THWGKEIP
     275-359: Missing.

Show »
Length:274
Mass (Da):30,766
Checksum:i53E8CA2E7CC1E2A8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z2Z6F2Z2Z6_HUMAN
Prostaglandin F2-alpha receptor
PTGFR
297Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042025267 – 359VTMAN…KSAST → GYRIILNGKEKYKVYEEQSD FLHRLQWPTLE in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_053588267 – 291VTMAN…LFALR → GYRIILNGKEKYKVYEEQSD FLHRK in isoform 4. CuratedAdd BLAST25
Alternative sequenceiVSP_053589267 – 275VTMANIGIN → KIEGKIKVT in isoform 3. Curated9
Alternative sequenceiVSP_053590267 – 274VTMANIGI → THWGKEIP in isoform 7. Curated8
Alternative sequenceiVSP_053591267V → R in isoform 6. Curated1
Alternative sequenceiVSP_053592268 – 359Missing in isoform 6. CuratedAdd BLAST92
Alternative sequenceiVSP_053593268 – 296TMANI…MATWN → KETHLQMRLWTWDFRVNALE DYCEGLTVF in isoform 5. CuratedAdd BLAST29
Alternative sequenceiVSP_053594275 – 359Missing in isoform 7. CuratedAdd BLAST85
Alternative sequenceiVSP_053595276 – 359Missing in isoform 3. CuratedAdd BLAST84
Alternative sequenceiVSP_053596292 – 359Missing in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_053597297 – 359Missing in isoform 5. CuratedAdd BLAST63

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L24470 mRNA Translation: AAA17684.1
AF004021 mRNA Translation: AAB63152.1
AY337000 mRNA Translation: AAQ76788.1
AY485530 mRNA Translation: AAR84381.1
AK292845 mRNA Translation: BAF85534.1
AC096531 Genomic DNA No translation available.
AL158841 Genomic DNA No translation available.
AL136324 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06351.1
BC112965 mRNA Translation: AAI12966.1
AB041713 Genomic DNA Translation: BAA94756.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS30759.1 [P43088-2]
CCDS686.1 [P43088-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A49973

NCBI Reference Sequences

More...RefSeqi		NP_000950.1, NM_000959.3 [P43088-1]
NP_001034674.1, NM_001039585.1 [P43088-2]
XP_016857362.1, XM_017001873.1 [P43088-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000370756; ENSP00000359792; ENSG00000122420 [P43088-2]
ENST00000370757; ENSP00000359793; ENSG00000122420 [P43088-1]
ENST00000370758; ENSP00000359794; ENSG00000122420 [P43088-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5737

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5737

UCSC genome browser

More...UCSCi		uc001dim.4, human [P43088-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24470 mRNA Translation: AAA17684.1
AF004021 mRNA Translation: AAB63152.1
AY337000 mRNA Translation: AAQ76788.1
AY485530 mRNA Translation: AAR84381.1
AK292845 mRNA Translation: BAF85534.1
AC096531 Genomic DNA No translation available.
AL158841 Genomic DNA No translation available.
AL136324 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06351.1
BC112965 mRNA Translation: AAI12966.1
AB041713 Genomic DNA Translation: BAA94756.1
CCDSiCCDS30759.1 [P43088-2]
CCDS686.1 [P43088-1]
PIRiA49973
RefSeqiNP_000950.1, NM_000959.3 [P43088-1]
NP_001034674.1, NM_001039585.1 [P43088-2]
XP_016857362.1, XM_017001873.1 [P43088-4]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi111709, 14 interactors
IntActiP43088, 9 interactors
STRINGi9606.ENSP00000359793

Chemistry databases

BindingDBiP43088
ChEMBLiCHEMBL1987
DrugBankiDB00905, Bimatoprost
DB01160, Dinoprost tromethamine
DB00654, Latanoprost
DB11660, Latanoprostene bunod
DB08819, Tafluprost
DB00287, Travoprost
DrugCentraliP43088
GuidetoPHARMACOLOGYi344
SwissLipidsiSLP:000001573

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

GlyGeniP43088, 2 sites
iPTMnetiP43088
PhosphoSitePlusiP43088

Genetic variation databases

BioMutaiPTGFR
DMDMi1172442

Proteomic databases

MassIVEiP43088
PaxDbiP43088
PeptideAtlasiP43088
PRIDEiP43088
ProteomicsDBi55578 [P43088-1]
55579 [P43088-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19743, 181 antibodies

The DNASU plasmid repository

More...DNASUi		5737

Genome annotation databases

EnsembliENST00000370756; ENSP00000359792; ENSG00000122420 [P43088-2]
ENST00000370757; ENSP00000359793; ENSG00000122420 [P43088-1]
ENST00000370758; ENSP00000359794; ENSG00000122420 [P43088-1]
GeneIDi5737
KEGGihsa:5737
UCSCiuc001dim.4, human [P43088-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5737
DisGeNETi5737

GeneCards: human genes, protein and diseases

More...GeneCardsi		PTGFR
HGNCiHGNC:9600, PTGFR
HPAiENSG00000122420, Low tissue specificity
MIMi600563, gene
neXtProtiNX_P43088
OpenTargetsiENSG00000122420
PharmGKBiPA290
VEuPathDBiHostDB:ENSG00000122420

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3656, Eukaryota
GeneTreeiENSGT01030000234559
HOGENOMiCLU_045991_3_0_1
InParanoidiP43088
OMAiMICQLLA
OrthoDBi972015at2759
PhylomeDBiP43088
TreeFamiTF324982

Enzyme and pathway databases

PathwayCommonsiP43088
ReactomeiR-HSA-391908, Prostanoid ligand receptors
R-HSA-416476, G alpha (q) signalling events
SIGNORiP43088

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5737, 7 hits in 1010 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PTGFR, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Prostaglandin_F_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5737
PharosiP43088, Tclin

Protein Ontology

More...PROi		PR:P43088
RNActiP43088, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000122420, Expressed in calcaneal tendon and 157 other tissues
ExpressionAtlasiP43088, baseline and differential
GenevisibleiP43088, HS

Family and domain databases

InterProiView protein in InterPro
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM
IPR000141, PglndnF_rcpt
IPR008365, Prostanoid_rcpt
PANTHERiPTHR11866, PTHR11866, 1 hit
PTHR11866:SF4, PTHR11866:SF4, 1 hit
PfamiView protein in Pfam
PF00001, 7tm_1, 1 hit
PRINTSiPR00237, GPCRRHODOPSN
PR01788, PROSTANOIDR
PR00855, PRSTNOIDFPR
PROSITEiView protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPF2R_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P43088
Secondary accession number(s): A8K9Y0
, Q2KHP3, Q6RYQ6, Q9P1X4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: September 29, 2021
This is version 183 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again