Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin F2-alpha receptor

Gene

PTGFR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum (By similarity). Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost.By similarity1 Publication

GO - Molecular functioni

  • prostaglandin F receptor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-391908 Prostanoid ligand receptors
R-HSA-416476 G alpha (q) signalling events

Chemistry databases

SwissLipidsiSLP:000001573

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin F2-alpha receptor
Short name:
PGF receptor
Short name:
PGF2-alpha receptor
Alternative name(s):
Prostanoid FP receptor
Gene namesi
Name:PTGFR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000122420.9
HGNCiHGNC:9600 PTGFR
MIMi600563 gene
neXtProtiNX_P43088

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 31ExtracellularSequence analysisAdd BLAST31
Transmembranei32 – 54Helical; Name=1Sequence analysisAdd BLAST23
Topological domaini55 – 69CytoplasmicSequence analysisAdd BLAST15
Transmembranei70 – 90Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini91 – 109ExtracellularSequence analysisAdd BLAST19
Transmembranei110 – 131Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini132 – 152CytoplasmicSequence analysisAdd BLAST21
Transmembranei153 – 175Helical; Name=4Sequence analysisAdd BLAST23
Topological domaini176 – 198ExtracellularSequence analysisAdd BLAST23
Transmembranei199 – 224Helical; Name=5Sequence analysisAdd BLAST26
Topological domaini225 – 250CytoplasmicSequence analysisAdd BLAST26
Transmembranei251 – 267Helical; Name=6Sequence analysisAdd BLAST17
Topological domaini268 – 285ExtracellularSequence analysisAdd BLAST18
Transmembranei286 – 307Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini308 – 359CytoplasmicSequence analysisAdd BLAST52

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5737
OpenTargetsiENSG00000122420
PharmGKBiPA290

Chemistry databases

ChEMBLiCHEMBL1987
DrugBankiDB00905 Bimatoprost
DB01160 Dinoprost Tromethamine
DB00654 Latanoprost
DB08819 Tafluprost
DB00287 Travoprost
GuidetoPHARMACOLOGYi344

Polymorphism and mutation databases

BioMutaiPTGFR
DMDMi1172442

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000700701 – 359Prostaglandin F2-alpha receptorAdd BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi4N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi19N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi108 ↔ 186PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP43088
PeptideAtlasiP43088
PRIDEiP43088
ProteomicsDBi55578
55579 [P43088-2]

PTM databases

iPTMnetiP43088
PhosphoSitePlusiP43088

Expressioni

Tissue specificityi

Eye.1 Publication

Gene expression databases

BgeeiENSG00000122420 Expressed in 136 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_PTGFR
ExpressionAtlasiP43088 baseline and differential
GenevisibleiP43088 HS

Interactioni

Subunit structurei

Isoform 1 can form heterodimers with isoform 5 (and probably other isoforms).1 Publication

Protein-protein interaction databases

BioGridi111709, 13 interactors
STRINGi9606.ENSP00000359793

Chemistry databases

BindingDBiP43088

Structurei

3D structure databases

ProteinModelPortaliP43088
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00760000119188
HOGENOMiHOG000015238
HOVERGENiHBG003621
InParanoidiP43088
KOiK04262
OMAiIIFMTVG
OrthoDBiEOG091G0A2S
PhylomeDBiP43088
TreeFamiTF324982

Family and domain databases

CDDicd15145 7tmA_FP, 1 hit
InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR000141 PglndnF_rcpt
IPR008365 Prostanoid_rcpt
PANTHERiPTHR11866 PTHR11866, 1 hit
PTHR11866:SF4 PTHR11866:SF4, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR01788 PROSTANOIDR
PR00855 PRSTNOIDFPR
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: P43088-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSMNNSKQLV SPAAALLSNT TCQTENRLSV FFSVIFMTVG ILSNSLAIAI
60 70 80 90 100
LMKAYQRFRQ KSKASFLLLA SGLVITDFFG HLINGAIAVF VYASDKEWIR
110 120 130 140 150
FDQSNVLCSI FGICMVFSGL CPLLLGSVMA IERCIGVTKP IFHSTKITSK
160 170 180 190 200
HVKMMLSGVC LFAVFIALLP ILGHRDYKIQ ASRTWCFYNT EDIKDWEDRF
210 220 230 240 250
YLLLFSFLGL LALGVSLLCN AITGITLLRV KFKSQQHRQG RSHHLEMVIQ
260 270 280 290 300
LLAIMCVSCI CWSPFLVTMA NIGINGNHSL ETCETTLFAL RMATWNQILD
310 320 330 340 350
PWVYILLRKA VLKNLYKLAS QCCGVHVISL HIWELSSIKN SLKVAAISES

PVAEKSAST
Length:359
Mass (Da):40,055
Last modified:November 1, 1995 - v1
Checksum:i08077045C0B20BCA
GO
Isoform 2 (identifier: P43088-2) [UniParc]FASTAAdd to basket
Also known as: FP(S), VAR-1

The sequence of this isoform differs from the canonical sequence as follows:
     267-359: VTMANIGING...SPVAEKSAST → GYRIILNGKEKYKVYEEQSDFLHRLQWPTLE

Show »
Length:297
Mass (Da):33,653
Checksum:i1D8C7CF32EE59529
GO
Isoform 3 (identifier: P43088-3) [UniParc]FASTAAdd to basket
Also known as: VAR-2

The sequence of this isoform differs from the canonical sequence as follows:
     267-275: VTMANIGIN → KIEGKIKVT
     276-359: Missing.

Show »
Length:275
Mass (Da):30,814
Checksum:i7FB54BA16E7CD983
GO
Isoform 4 (identifier: P43088-4) [UniParc]FASTAAdd to basket
Also known as: VAR-3

The sequence of this isoform differs from the canonical sequence as follows:
     267-291: VTMANIGINGNHSLETCETTLFALR → GYRIILNGKEKYKVYEEQSDFLHRK
     292-359: Missing.

Show »
Length:291
Mass (Da):32,913
Checksum:i41395134EB1B0802
GO
Isoform 5 (identifier: P43088-5) [UniParc]FASTAAdd to basket
Also known as: altFP4, VAR-4

The sequence of this isoform differs from the canonical sequence as follows:
     268-296: TMANIGINGNHSLETCETTLFALRMATWN → KETHLQMRLWTWDFRVNALEDYCEGLTVF
     297-359: Missing.

Show »
Length:296
Mass (Da):33,500
Checksum:i449FB52BF889E7E2
GO
Isoform 6 (identifier: P43088-6) [UniParc]FASTAAdd to basket
Also known as: VAR-5

The sequence of this isoform differs from the canonical sequence as follows:
     267-267: V → R
     268-359: Missing.

Show »
Length:267
Mass (Da):29,973
Checksum:iFD9F12B730760373
GO
Isoform 7 (identifier: P43088-7) [UniParc]FASTAAdd to basket
Also known as: VAR-6

The sequence of this isoform differs from the canonical sequence as follows:
     267-274: VTMANIGI → THWGKEIP
     275-359: Missing.

Show »
Length:274
Mass (Da):30,766
Checksum:i53E8CA2E7CC1E2A8
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z2Z6F2Z2Z6_HUMAN
Prostaglandin F2-alpha receptor
PTGFR
297Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042025267 – 359VTMAN…KSAST → GYRIILNGKEKYKVYEEQSD FLHRLQWPTLE in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_053588267 – 291VTMAN…LFALR → GYRIILNGKEKYKVYEEQSD FLHRK in isoform 4. CuratedAdd BLAST25
Alternative sequenceiVSP_053589267 – 275VTMANIGIN → KIEGKIKVT in isoform 3. Curated9
Alternative sequenceiVSP_053590267 – 274VTMANIGI → THWGKEIP in isoform 7. Curated8
Alternative sequenceiVSP_053591267V → R in isoform 6. Curated1
Alternative sequenceiVSP_053592268 – 359Missing in isoform 6. CuratedAdd BLAST92
Alternative sequenceiVSP_053593268 – 296TMANI…MATWN → KETHLQMRLWTWDFRVNALE DYCEGLTVF in isoform 5. CuratedAdd BLAST29
Alternative sequenceiVSP_053594275 – 359Missing in isoform 7. CuratedAdd BLAST85
Alternative sequenceiVSP_053595276 – 359Missing in isoform 3. CuratedAdd BLAST84
Alternative sequenceiVSP_053596292 – 359Missing in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_053597297 – 359Missing in isoform 5. CuratedAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24470 mRNA Translation: AAA17684.1
AF004021 mRNA Translation: AAB63152.1
AY337000 mRNA Translation: AAQ76788.1
AY485530 mRNA Translation: AAR84381.1
AK292845 mRNA Translation: BAF85534.1
AC096531 Genomic DNA No translation available.
AL158841 Genomic DNA No translation available.
AL136324 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06351.1
BC112965 mRNA Translation: AAI12966.1
AB041713 Genomic DNA Translation: BAA94756.1
CCDSiCCDS30759.1 [P43088-2]
CCDS686.1 [P43088-1]
PIRiA49973
RefSeqiNP_000950.1, NM_000959.3 [P43088-1]
NP_001034674.1, NM_001039585.1 [P43088-2]
XP_016857362.1, XM_017001873.1 [P43088-4]
UniGeneiHs.654365

Genome annotation databases

EnsembliENST00000370756; ENSP00000359792; ENSG00000122420 [P43088-2]
ENST00000370757; ENSP00000359793; ENSG00000122420 [P43088-1]
ENST00000370758; ENSP00000359794; ENSG00000122420 [P43088-1]
GeneIDi5737
KEGGihsa:5737
UCSCiuc001dim.4 human [P43088-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPF2R_HUMAN
AccessioniPrimary (citable) accession number: P43088
Secondary accession number(s): A8K9Y0
, Q2KHP3, Q6RYQ6, Q9P1X4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: September 12, 2018
This is version 164 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again