Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (13 Feb 2019)
Sequence version 1 (01 Nov 1995)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Mu-type opioid receptor

Gene

Oprm1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone. Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors. The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15. They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis. Isoform 9 is involved in morphine-induced scratching and seems to cross-activate GRPR in response to morphine.7 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-111885 Opioid Signalling
R-MMU-202040 G-protein activation
R-MMU-375276 Peptide ligand-binding receptors
R-MMU-418594 G alpha (i) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mu-type opioid receptor
Short name:
M-OR-1
Short name:
MOR-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Oprm1
Synonyms:Mor, Oprm
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:97441 Oprm1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 66Extracellular2 PublicationsAdd BLAST66
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei67 – 91Helical; Name=12 PublicationsAdd BLAST25
Topological domaini92 – 104Cytoplasmic2 PublicationsAdd BLAST13
Transmembranei105 – 129Helical; Name=22 PublicationsAdd BLAST25
Topological domaini130 – 140Extracellular2 PublicationsAdd BLAST11
Transmembranei141 – 163Helical; Name=32 PublicationsAdd BLAST23
Topological domaini164 – 183Cytoplasmic2 PublicationsAdd BLAST20
Transmembranei184 – 205Helical; Name=42 PublicationsAdd BLAST22
Topological domaini206 – 228Extracellular2 PublicationsAdd BLAST23
Transmembranei229 – 253Helical; Name=52 PublicationsAdd BLAST25
Topological domaini254 – 277Cytoplasmic2 PublicationsAdd BLAST24
Transmembranei278 – 304Helical; Name=62 PublicationsAdd BLAST27
Topological domaini305 – 312Extracellular2 Publications8
Transmembranei313 – 336Helical; Name=72 PublicationsAdd BLAST24
Topological domaini337 – 398Cytoplasmic2 PublicationsAdd BLAST62

Keywords - Cellular componenti

Cell membrane, Cell projection, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

During adult neurogenesis in hippocampus, increased numbers of granule cells maturing into neurons, larger granule cell layers and increased numbers of granule cells.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi387L → A: Abolishes receptor recycling; when associated with A-390. 1 Publication1
Mutagenesisi390L → A: Abolishes receptor recycling; when associated with A-387. 1 Publication1

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2858

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
319

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000699751 – 398Mu-type opioid receptorAdd BLAST398

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi9N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi31N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi38N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi46N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi140 ↔ 217PROSITE-ProRule annotationCombined sources2 Publications
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei166PhosphotyrosineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi351S-palmitoyl cysteineSequence analysis1
Modified residuei363PhosphoserineCombined sources1
Modified residuei370PhosphothreonineBy similarity1
Modified residuei375PhosphoserineBy similarity1
Modified residuei394PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Differentially phosphorylated in basal and agonist-induced conditions. Agonist-mediated phosphorylation modulates receptor internalization. Phosphorylated by GRK2 in a agonist-dependent manner. Phosphorylation at Tyr-166 requires receptor activation, is dependent on non-receptor protein tyrosine kinase Src and results in a decrease in agonist efficacy by reducing G-protein coupling efficiency. Phosphorylated on tyrosine residues; the phosphorylation is involved in agonist-induced G-protein-independent receptor down-regulation. Phosphorylation at Ser-375 is involved in G-protein-dependent but not beta-arrestin-dependent activation of the ERK pathway.By similarity
Ubiquitinated. A basal ubiquitination seems not to be related to degradation. Ubiquitination is increased upon formation of OPRM1:OPRD1 oligomers leading to proteasomal degradation; the ubiquitination is diminished by RTP4.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P42866

PRoteomics IDEntifications database

More...
PRIDEi
P42866

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P42866

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P42866

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P42866

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000000766 Expressed in 23 organ(s), highest expression level in cerebral cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P42866 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P42866 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms homooligomers and heterooligomers with other GPCRs, such as OPRD1, OPRK1, OPRL1, NPFFR2, ADRA2A, SSTR2, CNR1 and CCR5 (probably in dimeric forms) (PubMed:10842167, PubMed:12270145, PubMed:18836069, PubMed:21422164). Interacts with heterotrimeric G proteins; interaction with a heterotrimeric complex containing GNAI1, GNB1 and GNG2 stabilizes the active conformation of the receptor and increases its affinity for endomorphin-2, the synthetic opioid peptide DAMGO and for morphinan agonists (PubMed:26245379). Interacts with PPL; the interaction disrupts agonist-mediated G-protein activation. Interacts (via C-terminus) with DNAJB4 (via C-terminus). Interacts with calmodulin; the interaction inhibits the constitutive activity of OPRM1; it abolishes basal and attenuates agonist-stimulated G-protein coupling. Interacts with FLNA, PLD2, RANBP9 and WLS and GPM6A (By similarity). Interacts with RTP4 (PubMed:18836069). Interacts with SYP and GNAS (By similarity). Interacts with RGS9, RGS17, RGS20, RGS4, PPP1R9B and HINT1 (PubMed:15827571, PubMed:17725581, PubMed:18439408, PubMed:21153910). Isoform 9 interacts with GRPR (PubMed:22000021).By similarity11 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
201972, 3 interactors

Database of interacting proteins

More...
DIPi
DIP-46148N

Protein interaction database and analysis system

More...
IntActi
P42866, 11 interactors

Molecular INTeraction database

More...
MINTi
P42866

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000101236

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P42866

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1398
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4DKLX-ray2.80A52-360[»]
5C1MX-ray2.10A52-347[»]
6DDEelectron microscopy3.50R9-358[»]
6DDFelectron microscopy3.50R9-358[»]

Database of protein disorder

More...
DisProti
DP00974

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P42866

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P42866

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi332 – 336NPxxY; plays a role in stabilizing the activated conformation of the receptor1 Publication5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3656 Eukaryota
ENOG410XRW9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158236

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230486

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106919

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P42866

KEGG Orthology (KO)

More...
KOi
K04215

Database of Orthologous Groups

More...
OrthoDBi
1011272at2759

TreeFam database of animal gene trees

More...
TreeFami
TF315737

Family and domain databases

Conserved Domains Database

More...
CDDi
cd15090 7tmA_Mu_opioid_R, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR000105 Mu_opioid_rcpt
IPR001418 Opioid_rcpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00237 GPCRRHODOPSN
PR00537 MUOPIOIDR
PR00384 OPIOIDR

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (19+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 19 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Functional relevance for short isoforms with one transmembrane domain only is unsure and these isoforms are not included.

This entry has 19 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P42866-1) [UniParc]FASTAAdd to basket
Also known as: MOR-1, MOR-H, MOR-1J, MOR-1T

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSSAGPGNI SDCSDPLAPA SCSPAPGSWL NLSHVDGNQS DPCGPNRTGL
60 70 80 90 100
GGSHSLCPQT GSPSMVTAIT IMALYSIVCV VGLFGNFLVM YVIVRYTKMK
110 120 130 140 150
TATNIYIFNL ALADALATST LPFQSVNYLM GTWPFGNILC KIVISIDYYN
160 170 180 190 200
MFTSIFTLCT MSVDRYIAVC HPVKALDFRT PRNAKIVNVC NWILSSAIGL
210 220 230 240 250
PVMFMATTKY RQGSIDCTLT FSHPTWYWEN LLKICVFIFA FIMPVLIITV
260 270 280 290 300
CYGLMILRLK SVRMLSGSKE KDRNLRRITR MVLVVVAVFI VCWTPIHIYV
310 320 330 340 350
IIKALITIPE TTFQTVSWHF CIALGYTNSC LNPVLYAFLD ENFKRCFREF
360 370 380 390
CIPTSSTIEQ QNSARIRQNT REHPSTANTV DRTNHQLENL EAETAPLP
Length:398
Mass (Da):44,421
Last modified:November 1, 1995 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDFE1C758E2DA197E
GO
Isoform 2 (identifier: P42866-2) [UniParc]FASTAAdd to basket
Also known as: MOR-1A

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → VCAF

Show »
Length:390
Mass (Da):43,563
Checksum:i6B5B6A686C255294
GO
Isoform 3 (identifier: P42866-3) [UniParc]FASTAAdd to basket
Also known as: MOR-1B1

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → KIDLF

Show »
Length:391
Mass (Da):43,759
Checksum:iAC05BC14999C2552
GO
Isoform 4 (identifier: P42866-4) [UniParc]FASTAAdd to basket
Also known as: MOR-1B2

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → KLLMWRAMPTFKRHLAIMLSLDN

Show »
Length:409
Mass (Da):45,911
Checksum:i2DC2D18223481EA6
GO
Isoform 5 (identifier: P42866-5) [UniParc]FASTAAdd to basket
Also known as: MOR-1B3, MOR-1Q

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → TSLTLQ

Show »
Length:392
Mass (Da):43,786
Checksum:i0272F331816B0C25
GO
Isoform 6 (identifier: P42866-6) [UniParc]FASTAAdd to basket
Also known as: MOR-1B4, MOR-1R

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → AHQKPQECLKCRCLSLTILVICLHFQHQQFFIMIKKNVS

Show »
Length:425
Mass (Da):47,752
Checksum:iF4DF1831F0FFE9D8
GO
Isoform 7 (identifier: P42866-7) [UniParc]FASTAAdd to basket
Also known as: MOR-1B5, MOR-1P

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → CV

Show »
Length:388
Mass (Da):43,345
Checksum:iB6041C2552940375
GO
Isoform 8 (identifier: P42866-8) [UniParc]FASTAAdd to basket
Also known as: MOR-1C

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → PTLAVSVAQIFTGYPSPTHVEKPCKSCMDRGMRNLLPDDGPRQESGEGQLGR

Show »
Length:438
Mass (Da):48,753
Checksum:iC3EEFA233DC7B6AF
GO
Isoform 9 (identifier: P42866-9) [UniParc]FASTAAdd to basket
Also known as: MOR-1D

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → RNEEPSS

Show »
Length:393
Mass (Da):43,942
Checksum:i44A102A98DA09EAC
GO
Isoform 10 (identifier: P42866-10) [UniParc]FASTAAdd to basket
Also known as: MOR-1E, MOR-1Eiii, MOR-1Eiv

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → KKKLDSQRGCVQHPV

Show »
Length:401
Mass (Da):44,848
Checksum:i2C72C33B40623D9C
GO
Isoform 11 (identifier: P42866-11) [UniParc]FASTAAdd to basket
Also known as: MOR-1F

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → APCACVPGANRGQTKASDLLDLELETVGSHQADAETNPGPYEGSKCAEPLAISLVPLY

Show »
Length:444
Mass (Da):49,094
Checksum:iB813B308EBDBC7E2
GO
Isoform 12 (identifier: P42866-12) [UniParc]FASTAAdd to basket
Also known as: MOR-1O

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → PTLAVSVAQIFTGYPSPTHVEKPCKSCMDR

Show »
Length:416
Mass (Da):46,388
Checksum:i287DCE930F4215FA
GO
Isoform 13 (identifier: P42866-13) [UniParc]FASTAAdd to basket
Also known as: MOR-1P, MOR-1R

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → IMKFEAIYPK...LRHMGPSYPS

Show »
Length:453
Mass (Da):50,715
Checksum:i7C97FCCB51A405A0
GO
Isoform 14 (identifier: P42866-14) [UniParc]FASTAAdd to basket
Also known as: MOR-1G

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: MDSSAGPGNI...GNFLVMYVIV → MMEAFSKSAFQKLRQRDGNQEGKSYL

Show »
Length:330
Mass (Da):37,958
Checksum:iEFE198DA945CFD69
GO
Isoform 15 (identifier: P42866-15) [UniParc]FASTAAdd to basket
Also known as: MOR-1M

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: MDSSAGPGNI...GNFLVMYVIV → MMEAFSKSAFQKLRQRDGNQEGKSYL
     387-398: LENLEAETAPLP → PTLAVSVAQIFTGYPSPTHVEKPCKSCMDRGMRNLLPDDGPRQESGEGQLGR

Show »
Length:370
Mass (Da):42,290
Checksum:i3982458B31042392
GO
Isoform 16 (identifier: P42866-16) [UniParc]FASTAAdd to basket
Also known as: MOR-1N

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: MDSSAGPGNI...GNFLVMYVIV → MMEAFSKSAFQKLRQRDGNQEGKSYL
     387-398: LENLEAETAPLP → RNEEPSS

Show »
Length:325
Mass (Da):37,479
Checksum:iE245158D1F8F8102
GO
Isoform 17 (identifier: P42866-17) [UniParc]FASTAAdd to basket
Also known as: MOR-1U

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → PTLAVSVAQI...QESGEGQLGR

Show »
Length:474
Mass (Da):52,982
Checksum:i0CEE0C00E6885C99
GO
Isoform 18 (identifier: P42866-18) [UniParc]FASTAAdd to basket
Also known as: MOR-1V

The sequence of this isoform differs from the canonical sequence as follows:
     387-398: LENLEAETAPLP → KQEKTKTKSAWEIWEQKEHTLLLGETHLTIQHLS

Show »
Length:420
Mass (Da):47,197
Checksum:i2D5D6A022EFDAEFD
GO
Isoform 19 (identifier: P42866-19) [UniParc]FASTAAdd to basket
Also known as: MOR-1W

The sequence of this isoform differs from the canonical sequence as follows:
     388-398: ENLEAETAPLP → AFGCCNEHHDQR

Show »
Length:399
Mass (Da):44,654
Checksum:i6009B17CC0C8654A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q2X5E9Q2X5_MOUSE
Mu-type opioid receptor
Oprm1
337Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QAQ1E9QAQ1_MOUSE
Mu-type opioid receptor
Oprm1
448Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q7D4E9Q7D4_MOUSE
Mu-type opioid receptor
Oprm1
389Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J0Z2A0A0R4J0Z2_MOUSE
Mu-type opioid receptor
Oprm1
456Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q7D3E9Q7D3_MOUSE
Mu-type opioid receptor
Oprm1
393Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PVC1E9PVC1_MOUSE
Mu-type opioid receptor
Oprm1
356Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A1KZZ4A1KZZ4_MOUSE
Mu opioid receptor mMOR-1R1
Oprm1 Oprm
222Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q270E9Q270_MOUSE
Mu-type opioid receptor
Oprm1
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q4U2P9Q4U2P9_MOUSE
Mu opioid receptor isoform MOR-1Ha
Oprm1
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q4U2P0Q4U2P0_MOUSE
Mu opioid receptor isoform MOR-1K
Oprm1
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22C → W in AAA86878 (PubMed:7797593).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0423321 – 94MDSSA…MYVIV → MMEAFSKSAFQKLRQRDGNQ EGKSYL in isoform 14, isoform 15 and isoform 16. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_042333387 – 398LENLE…TAPLP → KKKLDSQRGCVQHPV in isoform 10. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_042334387 – 398LENLE…TAPLP → APCACVPGANRGQTKASDLL DLELETVGSHQADAETNPGP YEGSKCAEPLAISLVPLY in isoform 11. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042335387 – 398LENLE…TAPLP → PTLAVSVAQIFTGYPSPTHV EKPCKSCMDR in isoform 12. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042336387 – 398LENLE…TAPLP → IMKFEAIYPKLSFKSWALKY FTFIREKKRNTKAGALPTCH AGSPSQAHRGVAAWLLPLRH MGPSYPS in isoform 13. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042337387 – 398LENLE…TAPLP → PTLAVSVAQIFTGYPSPTHV EKPCKSCMDSVDCYNRKQQT GSLRKNKKKKKRRKNKQNIL EAGISRGMRNLLPDDGPRQE SGEGQLGR in isoform 17. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042338387 – 398LENLE…TAPLP → KQEKTKTKSAWEIWEQKEHT LLLGETHLTIQHLS in isoform 18. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042339387 – 398LENLE…TAPLP → VCAF in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042340387 – 398LENLE…TAPLP → KIDLF in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042341387 – 398LENLE…TAPLP → KLLMWRAMPTFKRHLAIMLS LDN in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042342387 – 398LENLE…TAPLP → TSLTLQ in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042343387 – 398LENLE…TAPLP → AHQKPQECLKCRCLSLTILV ICLHFQHQQFFIMIKKNVS in isoform 6. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042344387 – 398LENLE…TAPLP → CV in isoform 7. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042345387 – 398LENLE…TAPLP → PTLAVSVAQIFTGYPSPTHV EKPCKSCMDRGMRNLLPDDG PRQESGEGQLGR in isoform 8 and isoform 15. 4 PublicationsAdd BLAST12
Alternative sequenceiVSP_042346387 – 398LENLE…TAPLP → RNEEPSS in isoform 9 and isoform 16. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_042347388 – 398ENLEAETAPLP → AFGCCNEHHDQR in isoform 19. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U10561
, U10558, U10559, U10560 Genomic DNA Translation: AAB60673.1
U26915 mRNA Translation: AAA81170.1
U19380 mRNA Translation: AAA86878.1
AF062753 mRNA Translation: AAD54415.1
AF074973 mRNA Translation: AAD51861.1
AF074974 mRNA Translation: AAD51862.1
AF167565 mRNA Translation: AAL55581.1
AF167568 mRNA Translation: AAF79213.1
AB047546 mRNA Translation: BAB63338.1
AF062755 mRNA Translation: AAL34927.1
AF260311 mRNA Translation: AAL34400.1
AF074972 mRNA Translation: AAL34394.1
AF400246 mRNA Translation: AAL34507.1
AF400247 mRNA Translation: AAL34508.1
AF400248 mRNA Translation: AAL34509.1
AY036621 mRNA Translation: AAK74188.1
AY160190 mRNA Translation: AAO18365.1
AF167566 mRNA Translation: AAL55582.1
AF167567 mRNA Translation: AAL55583.1
AF346812 mRNA Translation: AAO13792.1
AF346813 mRNA Translation: AAO13793.1
AF346814 mRNA Translation: AAO13794.1
AK038389 mRNA Translation: BAC29982.1
DQ363376 mRNA Translation: ABC94862.1
DQ363377 mRNA Translation: ABC94863.1
DQ868787 mRNA Translation: ABI95796.1
DQ868788 mRNA Translation: ABI95797.2
EF105311 mRNA Translation: ABN45760.1
EF105312 mRNA Translation: ABN45761.1
EF105313 mRNA Translation: ABN45762.1
EF105314 mRNA Translation: ABN45763.1
CH466562 Genomic DNA Translation: EDL03560.1
CH466562 Genomic DNA Translation: EDL03561.1
CH466562 Genomic DNA Translation: EDL03562.1
AC153981 Genomic DNA No translation available.
AC155718 Genomic DNA No translation available.
AC164171 Genomic DNA No translation available.
BC119545 mRNA Translation: AAI19546.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56687.1 [P42866-8]
CCDS78783.1 [P42866-14]
CCDS78784.1 [P42866-15]
CCDS78785.1 [P42866-16]
CCDS78787.1 [P42866-1]
CCDS78788.1 [P42866-9]
CCDS83672.1 [P42866-4]
CCDS83673.1 [P42866-3]
CCDS83674.1 [P42866-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A57510

NCBI Reference Sequences

More...
RefSeqi
NP_001034741.1, NM_001039652.2 [P42866-8]
NP_001289722.1, NM_001302793.1 [P42866-1]
NP_001289723.1, NM_001302794.1 [P42866-14]
NP_001289724.1, NM_001302795.1 [P42866-15]
NP_001289725.1, NM_001302796.1 [P42866-16]
NP_001291866.1, NM_001304937.1 [P42866-2]
NP_001291867.1, NM_001304938.1 [P42866-3]
NP_001291877.1, NM_001304948.1 [P42866-4]
NP_001291879.1, NM_001304950.1 [P42866-9]
NP_001291884.1, NM_001304955.1 [P42866-17]
XP_017169315.1, XM_017313826.1
XP_017169316.1, XM_017313827.1 [P42866-6]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.438000
Mm.439715

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000000783; ENSMUSP00000000783; ENSMUSG00000000766 [P42866-6]
ENSMUST00000052751; ENSMUSP00000060329; ENSMUSG00000000766 [P42866-9]
ENSMUST00000056385; ENSMUSP00000060590; ENSMUSG00000000766 [P42866-1]
ENSMUST00000063036; ENSMUSP00000053498; ENSMUSG00000000766 [P42866-16]
ENSMUST00000092729; ENSMUSP00000090405; ENSMUSG00000000766 [P42866-7]
ENSMUST00000092731; ENSMUSP00000090407; ENSMUSG00000000766 [P42866-5]
ENSMUST00000092734; ENSMUSP00000090410; ENSMUSG00000000766 [P42866-1]
ENSMUST00000105602; ENSMUSP00000101227; ENSMUSG00000000766 [P42866-2]
ENSMUST00000105605; ENSMUSP00000101230; ENSMUSG00000000766 [P42866-3]
ENSMUST00000105607; ENSMUSP00000101232; ENSMUSG00000000766 [P42866-1]
ENSMUST00000105611; ENSMUSP00000101236; ENSMUSG00000000766 [P42866-8]
ENSMUST00000105615; ENSMUSP00000101240; ENSMUSG00000000766 [P42866-15]
ENSMUST00000135502; ENSMUSP00000135143; ENSMUSG00000000766 [P42866-12]
ENSMUST00000144264; ENSMUSP00000115836; ENSMUSG00000000766 [P42866-19]
ENSMUST00000147171; ENSMUSP00000117950; ENSMUSG00000000766 [P42866-14]
ENSMUST00000154906; ENSMUSP00000114342; ENSMUSG00000000766 [P42866-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
18390

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:18390

UCSC genome browser

More...
UCSCi
uc007eff.2 mouse [P42866-9]
uc007efl.2 mouse [P42866-17]
uc007efn.1 mouse [P42866-8]
uc007efp.2 mouse [P42866-15]
uc007efq.2 mouse [P42866-16]
uc007eft.1 mouse [P42866-12]
uc007efw.3 mouse [P42866-1]
uc007egc.2 mouse [P42866-14]
uc007ege.2 mouse [P42866-3]
uc007egf.2 mouse [P42866-2]
uc056yga.1 mouse [P42866-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10561
, U10558, U10559, U10560 Genomic DNA Translation: AAB60673.1
U26915 mRNA Translation: AAA81170.1
U19380 mRNA Translation: AAA86878.1
AF062753 mRNA Translation: AAD54415.1
AF074973 mRNA Translation: AAD51861.1
AF074974 mRNA Translation: AAD51862.1
AF167565 mRNA Translation: AAL55581.1
AF167568 mRNA Translation: AAF79213.1
AB047546 mRNA Translation: BAB63338.1
AF062755 mRNA Translation: AAL34927.1
AF260311 mRNA Translation: AAL34400.1
AF074972 mRNA Translation: AAL34394.1
AF400246 mRNA Translation: AAL34507.1
AF400247 mRNA Translation: AAL34508.1
AF400248 mRNA Translation: AAL34509.1
AY036621 mRNA Translation: AAK74188.1
AY160190 mRNA Translation: AAO18365.1
AF167566 mRNA Translation: AAL55582.1
AF167567 mRNA Translation: AAL55583.1
AF346812 mRNA Translation: AAO13792.1
AF346813 mRNA Translation: AAO13793.1
AF346814 mRNA Translation: AAO13794.1
AK038389 mRNA Translation: BAC29982.1
DQ363376 mRNA Translation: ABC94862.1
DQ363377 mRNA Translation: ABC94863.1
DQ868787 mRNA Translation: ABI95796.1
DQ868788 mRNA Translation: ABI95797.2
EF105311 mRNA Translation: ABN45760.1
EF105312 mRNA Translation: ABN45761.1
EF105313 mRNA Translation: ABN45762.1
EF105314 mRNA Translation: ABN45763.1
CH466562 Genomic DNA Translation: EDL03560.1
CH466562 Genomic DNA Translation: EDL03561.1
CH466562 Genomic DNA Translation: EDL03562.1
AC153981 Genomic DNA No translation available.
AC155718 Genomic DNA No translation available.
AC164171 Genomic DNA No translation available.
BC119545 mRNA Translation: AAI19546.1
CCDSiCCDS56687.1 [P42866-8]
CCDS78783.1 [P42866-14]
CCDS78784.1 [P42866-15]
CCDS78785.1 [P42866-16]
CCDS78787.1 [P42866-1]
CCDS78788.1 [P42866-9]
CCDS83672.1 [P42866-4]
CCDS83673.1 [P42866-3]
CCDS83674.1 [P42866-2]
PIRiA57510
RefSeqiNP_001034741.1, NM_001039652.2 [P42866-8]
NP_001289722.1, NM_001302793.1 [P42866-1]
NP_001289723.1, NM_001302794.1 [P42866-14]
NP_001289724.1, NM_001302795.1 [P42866-15]
NP_001289725.1, NM_001302796.1 [P42866-16]
NP_001291866.1, NM_001304937.1 [P42866-2]
NP_001291867.1, NM_001304938.1 [P42866-3]
NP_001291877.1, NM_001304948.1 [P42866-4]
NP_001291879.1, NM_001304950.1 [P42866-9]
NP_001291884.1, NM_001304955.1 [P42866-17]
XP_017169315.1, XM_017313826.1
XP_017169316.1, XM_017313827.1 [P42866-6]
UniGeneiMm.438000
Mm.439715

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4DKLX-ray2.80A52-360[»]
5C1MX-ray2.10A52-347[»]
6DDEelectron microscopy3.50R9-358[»]
6DDFelectron microscopy3.50R9-358[»]
DisProtiDP00974
ProteinModelPortaliP42866
SMRiP42866
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201972, 3 interactors
DIPiDIP-46148N
IntActiP42866, 11 interactors
MINTiP42866
STRINGi10090.ENSMUSP00000101236

Chemistry databases

BindingDBiP42866
ChEMBLiCHEMBL2858
GuidetoPHARMACOLOGYi319

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiP42866
PhosphoSitePlusiP42866
SwissPalmiP42866

Proteomic databases

PaxDbiP42866
PRIDEiP42866

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000000783; ENSMUSP00000000783; ENSMUSG00000000766 [P42866-6]
ENSMUST00000052751; ENSMUSP00000060329; ENSMUSG00000000766 [P42866-9]
ENSMUST00000056385; ENSMUSP00000060590; ENSMUSG00000000766 [P42866-1]
ENSMUST00000063036; ENSMUSP00000053498; ENSMUSG00000000766 [P42866-16]
ENSMUST00000092729; ENSMUSP00000090405; ENSMUSG00000000766 [P42866-7]
ENSMUST00000092731; ENSMUSP00000090407; ENSMUSG00000000766 [P42866-5]
ENSMUST00000092734; ENSMUSP00000090410; ENSMUSG00000000766 [P42866-1]
ENSMUST00000105602; ENSMUSP00000101227; ENSMUSG00000000766 [P42866-2]
ENSMUST00000105605; ENSMUSP00000101230; ENSMUSG00000000766 [P42866-3]
ENSMUST00000105607; ENSMUSP00000101232; ENSMUSG00000000766 [P42866-1]
ENSMUST00000105611; ENSMUSP00000101236; ENSMUSG00000000766 [P42866-8]
ENSMUST00000105615; ENSMUSP00000101240; ENSMUSG00000000766 [P42866-15]
ENSMUST00000135502; ENSMUSP00000135143; ENSMUSG00000000766 [P42866-12]
ENSMUST00000144264; ENSMUSP00000115836; ENSMUSG00000000766 [P42866-19]
ENSMUST00000147171; ENSMUSP00000117950; ENSMUSG00000000766 [P42866-14]
ENSMUST00000154906; ENSMUSP00000114342; ENSMUSG00000000766 [P42866-4]
GeneIDi18390
KEGGimmu:18390
UCSCiuc007eff.2 mouse [P42866-9]
uc007efl.2 mouse [P42866-17]
uc007efn.1 mouse [P42866-8]
uc007efp.2 mouse [P42866-15]
uc007efq.2 mouse [P42866-16]
uc007eft.1 mouse [P42866-12]
uc007efw.3 mouse [P42866-1]
uc007egc.2 mouse [P42866-14]
uc007ege.2 mouse [P42866-3]
uc007egf.2 mouse [P42866-2]
uc056yga.1 mouse [P42866-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4988
MGIiMGI:97441 Oprm1

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00940000158236
HOGENOMiHOG000230486
HOVERGENiHBG106919
InParanoidiP42866
KOiK04215
OrthoDBi1011272at2759
TreeFamiTF315737

Enzyme and pathway databases

ReactomeiR-MMU-111885 Opioid Signalling
R-MMU-202040 G-protein activation
R-MMU-375276 Peptide ligand-binding receptors
R-MMU-418594 G alpha (i) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Oprm1 mouse

Protein Ontology

More...
PROi
PR:P42866

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000000766 Expressed in 23 organ(s), highest expression level in cerebral cortex
ExpressionAtlasiP42866 baseline and differential
GenevisibleiP42866 MM

Family and domain databases

CDDicd15090 7tmA_Mu_opioid_R, 1 hit
InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR000105 Mu_opioid_rcpt
IPR001418 Opioid_rcpt
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR00537 MUOPIOIDR
PR00384 OPIOIDR
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOPRM_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P42866
Secondary accession number(s): A1XGX3
, A1XGX4, A1YAC3, A1YAC4, A5H7G2, Q4U2P4, Q4U2Q6, Q548C6, Q60768, Q6YC50, Q8CAN5, Q8CGW2, Q8CH73, Q8CH74, Q8CH75, Q8VBU3, Q8VBU6, Q8VBX8, Q8VI69, Q8VI70, Q8VI71, Q8VIN3, Q8VIN4, Q8VIN5, Q8VIN6, Q8VIP0, Q8VIP1, Q9JIY1, Q9R0D1, Q9R1L9, Q9R1M0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: February 13, 2019
This is version 169 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again