UniProtKB - P42771 (CDN2A_HUMAN)

>sp|P42771|CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE
LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Entry version 224 (12 Aug 2020)
Sequence version 2 (15 Jul 1998)
Previous versions | rss

Help video Add a publication Feedback

Protein

Cyclin-dependent kinase inhibitor 2A

Gene

CDKN2A

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.2 Publications

Caution

The proteins described here are encoded by the gene CDKN2A, but are completely unrelated in terms of sequence and function to tumor suppressor ARF (AC Q8N726) which is encoded by the same gene.Curated

GO - Molecular functionⁱ

Complete GO annotation on QuickGO ...

GO - Biological processⁱ

Complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Cell cycle

Biological process

Cell cycle

Enzyme and pathway databases

PathwayCommonsⁱ	P42771
Reactomeⁱ	R-HSA-2559580, Oxidative Stress Induced Senescence R-HSA-2559582, Senescence-Associated Secretory Phenotype (SASP) R-HSA-2559585, Oncogene Induced Senescence R-HSA-69231, Cyclin D associated events in G1 R-HSA-8853884, Transcriptional Regulation by VENTX R-HSA-9630791, Evasion of Oncogene Induced Senescence Due to Defective p16INK4A binding to CDK4 R-HSA-9630794, Evasion of Oncogene Induced Senescence Due to Defective p16INK4A binding to CDK4 and CDK6 R-HSA-9632697, Evasion of Oxidative Stress Induced Senescence Due to Defective p16INK4A binding to CDK4 R-HSA-9632700, Evasion of Oxidative Stress Induced Senescence Due to Defective p16INK4A binding to CDK4 and CDK6
SIGNORⁱ	P42771

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Cyclin-dependent kinase inhibitor 2AImported Alternative name(s): Cyclin-dependent kinase 4 inhibitor A Short name: CDK4I Multiple tumor suppressor 1 Short name: MTS-1 p16-INK4a Short name: p16-INK4 Short name: p16INK4A
Gene namesⁱ	Name:CDKN2AImported Synonyms:CDKN2, MTS1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 9

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000147889.16
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:1787, CDKN2A
MIMⁱ	600160, gene
neXtProtⁱ	NX_P42771

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus

Pathology & Biotechⁱ

Involvement in diseaseⁱ

The association between cutaneous and uveal melanomas in some families suggests that mutations in CDKN2A may account for a proportion of uveal melanomas. However, CDKN2A mutations are rarely found in uveal melanoma patients.

Melanoma, cutaneous malignant 2 (CMM2)12 Publications

Disease susceptibility is associated with variations affecting the gene represented in this entry.

Disease descriptionA malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but also may involve other sites.

Related information in OMIM

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_058549	19	A → ATA in CMM2; loss of CDK4 binding.	1
Natural variantⁱVAR_001413	24	R → C in CMM2.	1
Natural variantⁱVAR_001414	24	R → P in CMM2. 1 PublicationCorresponds to variant dbSNP:rs104894097EnsemblClinVar.	1
Natural variantⁱVAR_001416	32	L → P in CMM2. 1 PublicationCorresponds to variant dbSNP:rs878853650EnsemblClinVar.	1
Natural variantⁱVAR_001418	35	G → A in CMM2; also found in a biliary tract tumor and a patient with uveal melanoma; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs746834149EnsemblClinVar.	1
Natural variantⁱVAR_001419	35	G → E in CMM2. 1 PublicationCorresponds to variant dbSNP:rs746834149EnsemblClinVar.	1
Natural variantⁱVAR_058551	35	G → V in CMM2; loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs746834149EnsemblClinVar.	1
Natural variantⁱVAR_001420	48	P → L in CMM2; also found in head and neck tumor; somatic mutation. 1 Publication	1
Natural variantⁱVAR_001423	50	Q → R in CMM2. 1 PublicationCorresponds to variant dbSNP:rs587778189EnsemblClinVar.	1
Natural variantⁱVAR_001424	53	M → I in CMM2. 3 PublicationsCorresponds to variant dbSNP:rs104894095EnsemblClinVar.	1
Natural variantⁱVAR_001427	59	V → G in CMM2. 1 PublicationCorresponds to variant dbSNP:rs104894099EnsemblClinVar.	1
Natural variantⁱVAR_001430	62	L → P in CMM2.	1
Natural variantⁱVAR_058553	67	G → R in CMM2; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs758389471EnsemblClinVar.	1
Natural variantⁱVAR_001432	68	A → L in CMM2; requires 2 nucleotide substitutions. Corresponds to variant dbSNP:rs876658534EnsemblClinVar.	1
Natural variantⁱVAR_001437	71	N → K in CMM2.	1
Natural variantⁱVAR_058555	74	D → Y in CMM2; loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs760640852Ensembl.	1
Natural variantⁱVAR_058556	77	T → P in CMM2; loss of CDK4 binding. 1 Publication	1
Natural variantⁱVAR_058557	80	R → P in CMM2; loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs1057519883Ensembl.	1
Natural variantⁱVAR_058558	81	P → T in CMM2; loss of CDK4 binding. 1 Publication	1
Natural variantⁱVAR_001449	84	D → Y in CMM2; also found in a lung tumor and a prostate tumor. 1 PublicationCorresponds to variant dbSNP:rs11552822EnsemblClinVar.	1
Natural variantⁱVAR_001451	87	R → P in CMM2; impairs the function. 2 PublicationsCorresponds to variant dbSNP:rs878853647EnsemblClinVar.	1
Natural variantⁱVAR_012317	87	R → W in CMM2; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs749714198EnsemblClinVar.	1
Natural variantⁱVAR_001453	89	G → D in CMM2; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs137854599EnsemblClinVar.	1
Natural variantⁱVAR_001454	89	G → S in CMM2. Corresponds to variant dbSNP:rs137854597EnsemblClinVar.	1
Natural variantⁱVAR_023604	94	L → Q in CMM2. 1 Publication	1
Natural variantⁱVAR_001457	97	L → R in CMM2; loss of CDK4 binding. 1 Publication	1
Natural variantⁱVAR_001458	98	H → P in CMM2.	1
Natural variantⁱVAR_001459	98	H → Q in CMM2.	1
Natural variantⁱVAR_001460	99	R → P in CMM2; loss of CDK4 binding.	1
Natural variantⁱVAR_001462	100	A → L in CMM2; requires 2 nucleotide substitutions.	1
Natural variantⁱVAR_001464	101	G → W in CMM2 and FAMMMPC; impairs the function. 3 PublicationsCorresponds to variant dbSNP:rs104894094EnsemblClinVar.	1
Natural variantⁱVAR_001466	107	R → C in CMM2. 1 Publication	1
Natural variantⁱVAR_035068	112	R → RR in CMM2. 1 Publication	1
Natural variantⁱVAR_001471	117	L → M in CMM2; somatic mutation. 1 Publication	1
Natural variantⁱVAR_001472	118	A → T in CMM2. 1 PublicationCorresponds to variant dbSNP:rs1554653960EnsemblClinVar.	1
Natural variantⁱVAR_035069	122	G → R in CMM2. 1 PublicationCorresponds to variant dbSNP:rs113798404EnsemblClinVar.	1
Natural variantⁱVAR_001479	126	V → D in CMM2; impairs the function. 3 PublicationsCorresponds to variant dbSNP:rs104894098EnsemblClinVar.	1

Familial atypical multiple mole melanoma-pancreatic carcinoma syndrome (FAMMMPC)

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn inherited cancer predisposition syndrome characterized by an increased risk of developing malignant melanoma and/or pancreatic cancer. Mutation carriers within families may develop either or both types of cancer.

Related information in OMIM

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_001464	101	G → W in CMM2 and FAMMMPC; impairs the function. 3 PublicationsCorresponds to variant dbSNP:rs104894094EnsemblClinVar.		1

Melanoma-astrocytoma syndrome (MASTS)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionCharacterized by a dual predisposition to melanoma and neural system tumors, commonly astrocytoma.

Related information in OMIM

Keywords - Diseaseⁱ

Disease mutation, Li-Fraumeni syndrome, Tumor suppressor

Organism-specific databases

DisGeNET More...DisGeNETⁱ	1029
MalaCards human disease database More...MalaCardsⁱ	CDKN2A
MIMⁱ	155601, phenotype 155755, phenotype 606719, phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000147889
Orphanetⁱ	404560, Familial atypical multiple mole melanoma syndrome 618, Familial melanoma 1333, Familial pancreatic carcinoma 524, Li-Fraumeni syndrome 252206, Melanoma and neural system tumor syndrome 99860, Precursor B-cell acute lymphoblastic leukemia 99861, Precursor T-cell acute lymphoblastic leukemia
PharmGKBⁱ	PA106

Miscellaneous databases

Pharosⁱ	P42771, Tbio

Pharosⁱ

P42771, Tbio

Polymorphism and mutation databases

BioMutaⁱ	CDKN2A
DMDMⁱ	3041660

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000144177	1 – 156	Cyclin-dependent kinase inhibitor 2AAdd BLAST		156

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	1	N-acetylmethionineCombined sources	1
Modified residueⁱ	7	Phosphoserine1 Publication	1
Modified residueⁱ	8	Phosphoserine1 Publication	1
Modified residueⁱ	140	Phosphoserine1 Publication	1
Modified residueⁱ	152	Phosphoserine1 Publication	1

Post-translational modificationⁱ

Phosphorylation seems to increase interaction with CDK4.1 Publication

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal More...CPTACⁱ	CPTAC-333 CPTAC-334
EPDⁱ	P42771
jPOSTⁱ	P42771
MassIVEⁱ	P42771
PaxDbⁱ	P42771
PeptideAtlas More...PeptideAtlasⁱ	P42771
PRIDEⁱ	P42771
ProteomicsDBⁱ	33740 55551 [P42771-1] 55552 [P42771-2] 55553 [P42771-3] 55554 [P42771-4]
TopDownProteomicsⁱ	P42771-1 [P42771-1]

PTM databases

iPTMnetⁱ	P42771
PhosphoSitePlusⁱ	P42771

Expressionⁱ

Tissue specificityⁱ

Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000147889, Expressed in adenohypophysis and 208 other tissues
ExpressionAtlasⁱ	P42771, baseline and differential
Genevisibleⁱ	P42771, HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	ENSG00000147889, Tissue enhanced (blood, pituitary gland)

HPAⁱ

ENSG00000147889, Tissue enhanced (blood, pituitary gland)

Interactionⁱ

Subunit structureⁱ

Heterodimer with CDK4 or CDK6. Predominant p16 complexes contained CDK6.

Interacts with CDK4 (both 'T-172'-phosphorylated and non-phosphorylated forms); the interaction inhibits cyclin D-CDK4 kinase activity.

Interacts with ISCO2.

2 Publications

Binary interactionsⁱ

Hide details

P42771

With	#Exp.	IntAct
CDK4 [P11802]	14	EBI-375053,EBI-295644
CDK6 [Q00534]	15	EBI-375053,EBI-295663
CRELD2 [Q6UXH1]	2	EBI-375053,EBI-3935314
DEAF1 [O75398]	2	EBI-375053,EBI-718185
HNRNPU [Q00839]	2	EBI-375053,EBI-351126
MCM6 [Q14566]	4	EBI-375053,EBI-374900
PCNA [P12004]	8	EBI-375053,EBI-358311
TDRD7 [Q8NHU6]	2	EBI-375053,EBI-624505

GO - Molecular functionⁱ

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGRIDⁱ	107463, 233 interactors
CORUMⁱ	P42771
Database of interacting proteins More...DIPⁱ	DIP-6108N
IntActⁱ	P42771, 63 interactors
Molecular INTeraction database More...MINTⁱ	P42771
STRINGⁱ	9606.ENSP00000418915

Miscellaneous databases

RNActⁱ	P42771, protein

RNActⁱ

P42771, protein

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	4 – 6	Combined sources	3
Helixⁱ	15 – 22	Combined sources	8
Helixⁱ	25 – 32	Combined sources	8
Turnⁱ	33 – 35	Combined sources	3
Beta strandⁱ	43 – 45	Combined sources	3
Turnⁱ	48 – 50	Combined sources	3
Helixⁱ	57 – 64	Combined sources	8
Turnⁱ	65 – 67	Combined sources	3
Turnⁱ	75 – 77	Combined sources	3
Helixⁱ	81 – 88	Combined sources	8
Helixⁱ	91 – 100	Combined sources	10
Beta strandⁱ	109 – 111	Combined sources	3
Helixⁱ	114 – 121	Combined sources	8
Helixⁱ	124 – 130	Combined sources	7
Turnⁱ	133 – 135	Combined sources	3
Turnⁱ	141 – 143	Combined sources	3
Beta strandⁱ	145 – 147	Combined sources	3
Beta strandⁱ	150 – 153	Combined sources	4

Show more details

3D structure databases

SMRⁱ	P42771
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P42771

EvolutionaryTraceⁱ

P42771

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Repeatⁱ	11 – 40	ANK 1Add BLAST	30
Repeatⁱ	44 – 72	ANK 2Add BLAST	29
Repeatⁱ	77 – 106	ANK 3Add BLAST	30
Repeatⁱ	110 – 139	ANK 4Add BLAST	30

Sequence similaritiesⁱ

Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.Curated

Keywords - Domainⁱ

ANK repeat, Repeat

Phylogenomic databases

eggNOGⁱ	KOG0504, Eukaryota
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00940000163078
HOGENOMⁱ	CLU_2229116_0_0_1
InParanoidⁱ	P42771
KEGG Orthology (KO) More...KOⁱ	K06621
OMAⁱ	RDEDKGM
Database of Orthologous Groups More...OrthoDBⁱ	1435166at2759
TreeFamⁱ	TF352389

Family and domain databases

Gene3Dⁱ	1.25.40.20, 1 hit
InterProⁱ	View protein in InterPro IPR020683, Ankyrin_rpt-contain_dom IPR036770, Ankyrin_rpt-contain_sf
SUPFAMⁱ	SSF48403, SSF48403, 1 hit
PROSITEⁱ	View protein in PROSITE PS50297, ANK_REP_REGION, 1 hit

Sequences (6+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 6 isoformsⁱ produced by alternative splicing. Align Add to basket

Note: Isoform 1 and isoform tumor suppressor ARF arise due to the use of two alternative first exons joined to a common exon 2 at the same acceptor site but in different reading frames, resulting in two completely different isoforms.

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: P42771-1) [UniParc]FASTA Add to basket

Also known as: p16INK4a

This isoform has been chosen as the canonicalⁱ sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPAAGSSME PSADWLATAA ARGRVEEVRA LLEAGALPNA PNSYGRRPIQ 
        60         70         80         90        100
VMMMGSARVA ELLLLHGAEP NCADPATLTR PVHDAAREGF LDTLVVLHRA 
       110        120        130        140        150
GARLDVRDAW GRLPVDLAEE LGHRDVARYL RAAAGGTRGS NHARIDAAEG 

PSDIPD

Length:156

Mass (Da):16,533

Last modified:July 15, 1998 - v2

Checksum:ⁱE59C0E6174B48255

Isoform 2 (identifier: P42771-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-51: Missing.

« Hide

        10         20         30         40         50
MMMGSARVAE LLLLHGAEPN CADPATLTRP VHDAAREGFL DTLVVLHRAG 
        60         70         80         90        100
ARLDVRDAWG RLPVDLAEEL GHRDVARYLR AAAGGTRGSN HARIDAAEGP 

SDIPD

Show »

Length:105

Mass (Da):11,215

Checksum:ⁱ7F3FA00737E14285

Isoform 3 (identifier: P42771-3) [UniParc]FASTA Add to basket

Also known as: p12

The sequence of this isoform differs from the canonical sequence as follows:
52-116: MMMGSARVAE...RDAWGRLPVD → GRGSAAGAGD...LGAWEAKEEE
117-156: Missing.

« Hide

        10         20         30         40         50
MEPAAGSSME PSADWLATAA ARGRVEEVRA LLEAGALPNA PNSYGRRPIQ 
        60         70         80         90        100
VGRGSAAGAG DGGRLWRTKF AGELESGSAS ILRKKGRLPG EFSEGVCNHR 
       110 
PPPGDALGAW EAKEEE

Show »

Length:116

Mass (Da):12,083

Checksum:ⁱF451D0FE12C3B2DD

Isoform tumor suppressor ARF (identifier: Q8N726-1) [UniParc]FASTA Add to basket

Also known as: p14ARF, p19ARF

The sequence of this isoform can be found in the external entry Q8N726.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Length:132

Mass (Da):13,903

Isoform 5 (identifier: P42771-4) [UniParc]FASTA Add to basket

Also known as: p16gamma

The sequence of this isoform differs from the canonical sequence as follows:
153-156: DIPD → EMIGNHLWVCRSRHA

« Hide

        10         20         30         40         50
MEPAAGSSME PSADWLATAA ARGRVEEVRA LLEAGALPNA PNSYGRRPIQ 
        60         70         80         90        100
VMMMGSARVA ELLLLHGAEP NCADPATLTR PVHDAAREGF LDTLVVLHRA 
       110        120        130        140        150
GARLDVRDAW GRLPVDLAEE LGHRDVARYL RAAAGGTRGS NHARIDAAEG 
       160 
PSEMIGNHLW VCRSRHA

Note: Barely detectable in non-tumor cells.Curated

Show »

Length:167

Mass (Da):17,883

Checksum:ⁱ07328B24CC7ECC61

Isoform smARF (identifier: Q8N726-2) [UniParc]FASTA Add to basket

The sequence of this isoform can be found in the external entry Q8N726.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Length:85

Mass (Da):8,731

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

K7ES20	K7ES20_HUMAN	Cyclin-dependent kinase inhibitor 2... Cyclin-dependent kinase inhibitor 2A	CDKN2A	104	Annotation score:
K7ENC6	K7ENC6_HUMAN	Cyclin-dependent kinase inhibitor 2... Cyclin-dependent kinase inhibitor 2A	CDKN2A	121	Annotation score:
J3QRG6	J3QRG6_HUMAN	Cyclin-dependent kinase inhibitor 2... Cyclin-dependent kinase inhibitor 2A	CDKN2A	138	Annotation score:

Sequence cautionⁱ

The sequence AAB60645 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Isoform 3 (identifier: P42771-3)
Sequence conflictⁱ	54	G → R in AAD11437 (PubMed:10445844).Curated	1
Sequence conflictⁱ	112	A → T in AAD11437 (PubMed:10445844).Curated	1

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_001408	14	D → E in a biliary tract tumor.	1
Natural variantⁱVAR_001409	16	L → P in a biliary tract tumor and a familial melanoma.	1
Natural variantⁱVAR_058549	19	A → ATA in CMM2; loss of CDK4 binding.	1
Natural variantⁱVAR_001410	20	A → P in a lung tumor and melanoma.	1
Natural variantⁱVAR_001411	20	A → S in a biliary tract tumor. Corresponds to variant dbSNP:rs760065045Ensembl.	1
Natural variantⁱVAR_001412	23	G → D in a pancreas tumor and a melanoma; loss of CDK4 binding. Corresponds to variant dbSNP:rs1064794292EnsemblClinVar.	1
Natural variantⁱVAR_001413	24	R → C in CMM2.	1
Natural variantⁱVAR_001414	24	R → P in CMM2. 1 PublicationCorresponds to variant dbSNP:rs104894097EnsemblClinVar.	1
Natural variantⁱVAR_058550	24	R → Q Found in a patient with multiple primary melanoma; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs104894097EnsemblClinVar.	1
Natural variantⁱVAR_001415	26	E → D in a biliary tract tumor.	1
Natural variantⁱVAR_001416	32	L → P in CMM2. 1 PublicationCorresponds to variant dbSNP:rs878853650EnsemblClinVar.	1
Natural variantⁱVAR_001417	33	E → D in a biliary tract tumor.	1
Natural variantⁱVAR_001418	35	G → A in CMM2; also found in a biliary tract tumor and a patient with uveal melanoma; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs746834149EnsemblClinVar.	1
Natural variantⁱVAR_001419	35	G → E in CMM2. 1 PublicationCorresponds to variant dbSNP:rs746834149EnsemblClinVar.	1
Natural variantⁱVAR_058551	35	G → V in CMM2; loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs746834149EnsemblClinVar.	1
Natural variantⁱVAR_001420	48	P → L in CMM2; also found in head and neck tumor; somatic mutation. 1 Publication	1
Natural variantⁱVAR_001421	49	I → S in a biliary tract tumor. Corresponds to variant dbSNP:rs199907548EnsemblClinVar.	1
Natural variantⁱVAR_001422	49	I → T2 PublicationsCorresponds to variant dbSNP:rs199907548EnsemblClinVar.	1
Natural variantⁱVAR_001423	50	Q → R in CMM2. 1 PublicationCorresponds to variant dbSNP:rs587778189EnsemblClinVar.	1
Natural variantⁱVAR_001424	53	M → I in CMM2. 3 PublicationsCorresponds to variant dbSNP:rs104894095EnsemblClinVar.	1
Natural variantⁱVAR_001425	56	S → I Possible polymorphism. Corresponds to variant dbSNP:rs104894109EnsemblClinVar.	1
Natural variantⁱVAR_001426	57	A → V in pancreas carcinoma; somatic mutation; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs372266620EnsemblClinVar.	1
Natural variantⁱVAR_001427	59	V → G in CMM2. 1 PublicationCorresponds to variant dbSNP:rs104894099EnsemblClinVar.	1
Natural variantⁱVAR_001428	60	A → T. Corresponds to variant dbSNP:rs769382085EnsemblClinVar.	1
Natural variantⁱVAR_053028	60	A → V in melanoma; loss of CDK4 binding. Corresponds to variant dbSNP:rs36204594EnsemblClinVar.	1
Natural variantⁱVAR_001429	61 – 62	EL → DV.	2
Natural variantⁱVAR_001430	62	L → P in CMM2.	1
Natural variantⁱVAR_001431	66	H → Y in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_058552	67 – 71	Missing in melanoma; loss of CDK4 binding. 1 Publication	5
Natural variantⁱVAR_058553	67	G → R in CMM2; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs758389471EnsemblClinVar.	1
Natural variantⁱVAR_001432	68	A → L in CMM2; requires 2 nucleotide substitutions. Corresponds to variant dbSNP:rs876658534EnsemblClinVar.	1
Natural variantⁱVAR_001433	68	A → T in an esophagus tumor.	1
Natural variantⁱVAR_001434	68	A → V1 PublicationCorresponds to variant dbSNP:rs1060501260EnsemblClinVar.	1
Natural variantⁱVAR_058554	69	E → G Found in some patients with melanoma; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs372670098EnsemblClinVar.	1
Natural variantⁱVAR_001435	69	E → K in a bladder tumor.	1
Natural variantⁱVAR_001436	69	E → V in a lung tumor.	1
Natural variantⁱVAR_001437	71	N → K in CMM2.	1
Natural variantⁱVAR_001438	71	N → S2 PublicationsCorresponds to variant dbSNP:rs559848002EnsemblClinVar.	1
Natural variantⁱVAR_001439	72	C → G in an esophagus tumor.	1
Natural variantⁱVAR_001440	74	D → N in a bladder tumor.	1
Natural variantⁱVAR_001441	74	D → V in a biliary tract tumor.	1
Natural variantⁱVAR_058555	74	D → Y in CMM2; loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs760640852Ensembl.	1
Natural variantⁱVAR_058556	77	T → P in CMM2; loss of CDK4 binding. 1 Publication	1
Natural variantⁱVAR_001442	80	R → L in a head and neck tumor.	1
Natural variantⁱVAR_058557	80	R → P in CMM2; loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs1057519883Ensembl.	1
Natural variantⁱVAR_001443	81	P → L in some patients with melanoma; impairs the function. 1 PublicationCorresponds to variant dbSNP:rs11552823Ensembl.	1
Natural variantⁱVAR_058558	81	P → T in CMM2; loss of CDK4 binding. 1 Publication	1
Natural variantⁱVAR_001445	83	H → N in a lung tumor.	1
Natural variantⁱVAR_053029	83	H → Q. Corresponds to variant dbSNP:rs34968276EnsemblClinVar.	1
Natural variantⁱVAR_001444	83	H → Y in a pancreas tumor; also found in head and neck tumor. Corresponds to variant dbSNP:rs121913385EnsemblClinVar.	1
Natural variantⁱVAR_001446	84	D → E in a bladder tumor.	1
Natural variantⁱVAR_001447	84	D → H in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_001448	84	D → N in an esophagus tumor; also found in head and neck tumor; also found in a lung tumor. Corresponds to variant dbSNP:rs11552822EnsemblClinVar.	1
Natural variantⁱVAR_001449	84	D → Y in CMM2; also found in a lung tumor and a prostate tumor. 1 PublicationCorresponds to variant dbSNP:rs11552822EnsemblClinVar.	1
Natural variantⁱVAR_001450	85	A → T1 PublicationCorresponds to variant dbSNP:rs878853646EnsemblClinVar.	1
Natural variantⁱVAR_001451	87	R → P in CMM2; impairs the function. 2 PublicationsCorresponds to variant dbSNP:rs878853647EnsemblClinVar.	1
Natural variantⁱVAR_012317	87	R → W in CMM2; partial loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs749714198EnsemblClinVar.	1
Natural variantⁱVAR_001452	88	E → D in a biliary tract tumor.	1
Natural variantⁱVAR_001453	89	G → D in CMM2; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs137854599EnsemblClinVar.	1
Natural variantⁱVAR_001454	89	G → S in CMM2. Corresponds to variant dbSNP:rs137854597EnsemblClinVar.	1
Natural variantⁱVAR_001455	93	T → A in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_023604	94	L → Q in CMM2. 1 Publication	1
Natural variantⁱVAR_001456	95	V → A in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_001457	97	L → R in CMM2; loss of CDK4 binding. 1 Publication	1
Natural variantⁱVAR_001458	98	H → P in CMM2.	1
Natural variantⁱVAR_001459	98	H → Q in CMM2.	1
Natural variantⁱVAR_001460	99	R → P in CMM2; loss of CDK4 binding.	1
Natural variantⁱVAR_001461	99	R → Q in non-small cell lung carcinoma. 1 PublicationCorresponds to variant dbSNP:rs754806883EnsemblClinVar.	1
Natural variantⁱVAR_053030	99	R → W. Corresponds to variant dbSNP:rs34886500EnsemblClinVar.	1
Natural variantⁱVAR_001462	100	A → L in CMM2; requires 2 nucleotide substitutions.	1
Natural variantⁱVAR_001463	100	A → P.	1
Natural variantⁱVAR_001464	101	G → W in CMM2 and FAMMMPC; impairs the function. 3 PublicationsCorresponds to variant dbSNP:rs104894094EnsemblClinVar.	1
Natural variantⁱVAR_015818	102	A → E Found in seminoma and medulloblastoma tissues from Li-Fraumeni syndrome patients carrying a mutation in TP53; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs137854598EnsemblClinVar.	1
Natural variantⁱVAR_053031	102	A → T. Corresponds to variant dbSNP:rs35741010EnsemblClinVar.	1
Natural variantⁱVAR_001465	104 – 105	Missing .	2
Natural variantⁱVAR_001466	107	R → C in CMM2. 1 Publication	1
Natural variantⁱVAR_001467	107	R → H. Corresponds to variant dbSNP:rs370823171EnsemblClinVar.	1
Natural variantⁱVAR_001469	108	D → H in a bladder tumor.	1
Natural variantⁱVAR_001468	108	D → Y in a head and neck tumor. Corresponds to variant dbSNP:rs121913381EnsemblClinVar.	1
Natural variantⁱVAR_035068	112	R → RR in CMM2. 1 Publication	1
Natural variantⁱVAR_001470	114	P → L in non-small cell lung carcinoma. 1 PublicationCorresponds to variant dbSNP:rs121913386Ensembl.	1
Natural variantⁱVAR_058559	114	P → S Found in some patients with melanoma; loss of CDK4 binding. 1 PublicationCorresponds to variant dbSNP:rs104894104Ensembl.	1
Natural variantⁱVAR_001471	117	L → M in CMM2; somatic mutation. 1 Publication	1
Natural variantⁱVAR_001472	118	A → T in CMM2. 1 PublicationCorresponds to variant dbSNP:rs1554653960EnsemblClinVar.	1
Natural variantⁱVAR_001473	119	E → Q in a biliary tract tumor.	1
Natural variantⁱVAR_001474	120	E → A in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_001475	120	E → K in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_035069	122	G → R in CMM2. 1 PublicationCorresponds to variant dbSNP:rs113798404EnsemblClinVar.	1
Natural variantⁱVAR_001476	122	G → S in a biliary tract tumor. Corresponds to variant dbSNP:rs113798404EnsemblClinVar.	1
Natural variantⁱVAR_001477	123	H → Q in leukemia. Corresponds to variant dbSNP:rs6413463EnsemblClinVar.	1
Natural variantⁱVAR_053032	124	R → C. Corresponds to variant dbSNP:rs34170727EnsemblClinVar.	1
Natural variantⁱVAR_001478	124	R → H in an esophagus tumor. Corresponds to variant dbSNP:rs747621669Ensembl.	1
Natural variantⁱVAR_001479	126	V → D in CMM2; impairs the function. 3 PublicationsCorresponds to variant dbSNP:rs104894098EnsemblClinVar.	1
Natural variantⁱVAR_001480	127	A → S in squamous cell carcinoma. 1 PublicationCorresponds to variant dbSNP:rs6413464EnsemblClinVar.	1
Natural variantⁱVAR_001481	132	A → P in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_001482	134	A → V in non-small cell lung carcinoma. 1 PublicationCorresponds to variant dbSNP:rs757497674Ensembl.	1
Natural variantⁱVAR_001483	142	H → Y in non-small cell lung carcinoma. 1 Publication	1
Natural variantⁱVAR_001484	144	R → C in squamous cell carcinoma. 1 PublicationCorresponds to variant dbSNP:rs116150891EnsemblClinVar.	1
Natural variantⁱVAR_001486	148	A → T7 PublicationsCorresponds to variant dbSNP:rs3731249EnsemblClinVar.	1
Natural variantⁱVAR_001487	150	G → V in non-small cell lung carcinoma. 1 Publication	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Length
Alternative sequenceⁱVSP_015864	1 – 51	Missing in isoform 2. CuratedAdd BLAST	51
Alternative sequenceⁱVSP_015865	52 – 116	MMMGS…RLPVD → GRGSAAGAGDGGRLWRTKFA GELESGSASILRKKGRLPGE FSEGVCNHRPPPGDALGAWE AKEEE in isoform 3. 1 PublicationAdd BLAST	65
Alternative sequenceⁱVSP_015866	117 – 156	Missing in isoform 3. 1 PublicationAdd BLAST	40
Alternative sequenceⁱVSP_043577	153 – 156	DIPD → EMIGNHLWVCRSRHA in isoform 5. 1 Publication	4

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L27211 mRNA Translation: AAA92554.1 AF115544 mRNA Translation: AAD11437.1 AB060808 Genomic DNA Translation: BAB91133.1 AF527803 Genomic DNA Translation: AAR05391.1 DQ318021 mRNA Translation: ABC47036.1 AL449423 Genomic DNA No translation available. CH471071 Genomic DNA Translation: EAW58598.1 CH471071 Genomic DNA Translation: EAW58599.1 CH471071 Genomic DNA Translation: EAW58603.1 X94154 Genomic DNA Translation: CAA63870.1 AH007355 Genomic DNA Translation: AAD14050.1 S69804 Genomic DNA Translation: AAD14048.1 U12820, U12818, U12819 Genomic DNA Translation: AAB60645.1 Different initiation.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS56565.1 [P42771-4] CCDS6510.1 [P42771-1] CCDS87644.1 [P42771-2]
PIRⁱ	JE0141
NCBI Reference Sequences More...RefSeqⁱ	NP_000068.1, NM_000077.4 [P42771-1] NP_001182061.1, NM_001195132.1 [P42771-4] NP_478104.2, NM_058197.4 [P42771-3] XP_005251400.1, XM_005251343.1 [P42771-2] XP_011515981.1, XM_011517679.1

Genome annotation databases

Ensemblⁱ	ENST00000304494; ENSP00000307101; ENSG00000147889 [P42771-1] ENST00000380151; ENSP00000369496; ENSG00000147889 [P42771-3] ENST00000494262; ENSP00000464952; ENSG00000147889 [P42771-2] ENST00000498124; ENSP00000418915; ENSG00000147889 [P42771-4] ENST00000498628; ENSP00000467857; ENSG00000147889 [P42771-2] ENST00000578845; ENSP00000467390; ENSG00000147889 [P42771-2]
GeneIDⁱ	1029
KEGGⁱ	hsa:1029
UCSC genome browser More...UCSCⁱ	uc003zpj.4, human uc003zpk.4, human [P42771-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P42771	Cyclin-dependent kinase inhibitor 2A		HUMAN		156	UniRef100_P42771
Isoform 2 of Cyclin-dependent kinase inhibitor 2A		HUMAN		105
P42771-3	CDKN2A isoform 8		PANTR		116	UniRef100_A0A2J8QSK3
p16 (Fragment)		HUMAN		67
Q8N726-2	Tumor suppressor ARF		HUMAN		132	UniRef100_Q8N726

Protein	Similar proteins		Species	Score	Length	Source
P42771	Cyclin-dependent kinase inhibitor 2A		HUMAN		156	UniRef90_P42771
CDKN2A isoform 6		PANTR		167
ANK_REP_REGION domain-containing protein		PANPA		167
Cyclin dependent kinase inhibitor 2A		GORGO		167
ANK_REP_REGION domain-containing protein		MACFA		160
+45
P42771-3	CDKN2A isoform 8		PANTR		116	UniRef90_A0A2J8QSK3
p16 (Fragment)		HUMAN		67
Q8N726-2	Tumor suppressor ARF		HUMAN		132	UniRef90_Q8N726
Uncharacterized protein		MACNE		132
Uncharacterized protein		COLAP		132
Uncharacterized protein		Cebus capucinus imitator		132
Uncharacterized protein		MACFA		132
+2

Protein	Similar proteins		Species	Score	Length	Source
P42771	Cyclin-dependent kinase inhibitor 2A		HUMAN		156	UniRef50_P42771
CDKN2A isoform 6		PANTR		167
ANK_REP_REGION domain-containing protein		PANPA		167
Cyclin dependent kinase inhibitor 2A		GORGO		167
ANK_REP_REGION domain-containing protein		MACFA		160
+47
P42771-3	CDKN2A isoform 8		PANTR		116	UniRef50_A0A2J8QSK3
p16 (Fragment)		HUMAN		67
Q8N726-2	Tumor suppressor ARF		HUMAN		132	UniRef50_Q8N726
Cyclin dependent kinase inhibitor 2A		SAIBB		132
Uncharacterized protein		MACNE		132
Uncharacterized protein		CERAT		132
Uncharacterized protein		MACFA		132
+23

Cross-referencesⁱ

Web resourcesⁱ

CDKN2A Database

Database of CDKN2A germline and somatic variants

NIEHS-SNPs

Wikipedia

P16INK4a entry

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L27211 mRNA Translation: AAA92554.1 AF115544 mRNA Translation: AAD11437.1 AB060808 Genomic DNA Translation: BAB91133.1 AF527803 Genomic DNA Translation: AAR05391.1 DQ318021 mRNA Translation: ABC47036.1 AL449423 Genomic DNA No translation available. CH471071 Genomic DNA Translation: EAW58598.1 CH471071 Genomic DNA Translation: EAW58599.1 CH471071 Genomic DNA Translation: EAW58603.1 X94154 Genomic DNA Translation: CAA63870.1 AH007355 Genomic DNA Translation: AAD14050.1 S69804 Genomic DNA Translation: AAD14048.1 U12820, U12818, U12819 Genomic DNA Translation: AAB60645.1 Different initiation.
CCDSⁱ	CCDS56565.1 [P42771-4] CCDS6510.1 [P42771-1] CCDS87644.1 [P42771-2]
PIRⁱ	JE0141
RefSeqⁱ	NP_000068.1, NM_000077.4 [P42771-1] NP_001182061.1, NM_001195132.1 [P42771-4] NP_478104.2, NM_058197.4 [P42771-3] XP_005251400.1, XM_005251343.1 [P42771-2] XP_011515981.1, XM_011517679.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1A5E	NMR	-	A	1-156	[»]
	1BI7	X-ray	3.40	B	1-156	[»]
	1DC2	NMR	-	A	1-156	[»]
	2A5E	NMR	-	A	1-156	[»]
SMRⁱ	P42771
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Protein-protein interaction databases

BioGRIDⁱ	107463, 233 interactors
CORUMⁱ	P42771
DIPⁱ	DIP-6108N
IntActⁱ	P42771, 63 interactors
MINTⁱ	P42771
STRINGⁱ	9606.ENSP00000418915

PTM databases

iPTMnetⁱ	P42771
PhosphoSitePlusⁱ	P42771

Polymorphism and mutation databases

BioMutaⁱ	CDKN2A
DMDMⁱ	3041660

Proteomic databases

CPTACⁱ	CPTAC-333 CPTAC-334
EPDⁱ	P42771
jPOSTⁱ	P42771
MassIVEⁱ	P42771
PaxDbⁱ	P42771
PeptideAtlasⁱ	P42771
PRIDEⁱ	P42771
ProteomicsDBⁱ	33740 55551 [P42771-1] 55552 [P42771-2] 55553 [P42771-3] 55554 [P42771-4]
TopDownProteomicsⁱ	P42771-1 [P42771-1]

Protocols and materials databases

ABCDⁱ	P42771, 8 sequenced antibodies
Antibodypediaⁱ	3608, 1402 antibodies
The DNASU plasmid repository More...DNASUⁱ	1029

Genome annotation databases

Ensemblⁱ	ENST00000304494; ENSP00000307101; ENSG00000147889 [P42771-1] ENST00000380151; ENSP00000369496; ENSG00000147889 [P42771-3] ENST00000494262; ENSP00000464952; ENSG00000147889 [P42771-2] ENST00000498124; ENSP00000418915; ENSG00000147889 [P42771-4] ENST00000498628; ENSP00000467857; ENSG00000147889 [P42771-2] ENST00000578845; ENSP00000467390; ENSG00000147889 [P42771-2]
GeneIDⁱ	1029
KEGGⁱ	hsa:1029
UCSCⁱ	uc003zpj.4, human uc003zpk.4, human [P42771-1]

Organism-specific databases

CTDⁱ	1029
DisGeNETⁱ	1029
EuPathDBⁱ	HostDB:ENSG00000147889.16
GeneCardsⁱ	CDKN2A
HGNCⁱ	HGNC:1787, CDKN2A
HPAⁱ	ENSG00000147889, Tissue enhanced (blood, pituitary gland)
MalaCardsⁱ	CDKN2A
MIMⁱ	155601, phenotype 155755, phenotype 600160, gene 606719, phenotype
neXtProtⁱ	NX_P42771
OpenTargetsⁱ	ENSG00000147889
Orphanetⁱ	404560, Familial atypical multiple mole melanoma syndrome 618, Familial melanoma 1333, Familial pancreatic carcinoma 524, Li-Fraumeni syndrome 252206, Melanoma and neural system tumor syndrome 99860, Precursor B-cell acute lymphoblastic leukemia 99861, Precursor T-cell acute lymphoblastic leukemia
PharmGKBⁱ	PA106
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0504, Eukaryota
GeneTreeⁱ	ENSGT00940000163078
HOGENOMⁱ	CLU_2229116_0_0_1
InParanoidⁱ	P42771
KOⁱ	K06621
OMAⁱ	RDEDKGM
OrthoDBⁱ	1435166at2759
TreeFamⁱ	TF352389

Enzyme and pathway databases

PathwayCommonsⁱ	P42771
Reactomeⁱ	R-HSA-2559580, Oxidative Stress Induced Senescence R-HSA-2559582, Senescence-Associated Secretory Phenotype (SASP) R-HSA-2559585, Oncogene Induced Senescence R-HSA-69231, Cyclin D associated events in G1 R-HSA-8853884, Transcriptional Regulation by VENTX R-HSA-9630791, Evasion of Oncogene Induced Senescence Due to Defective p16INK4A binding to CDK4 R-HSA-9630794, Evasion of Oncogene Induced Senescence Due to Defective p16INK4A binding to CDK4 and CDK6 R-HSA-9632697, Evasion of Oxidative Stress Induced Senescence Due to Defective p16INK4A binding to CDK4 R-HSA-9632700, Evasion of Oxidative Stress Induced Senescence Due to Defective p16INK4A binding to CDK4 and CDK6
SIGNORⁱ	P42771

Miscellaneous databases

BioGRID-ORCSⁱ	1029, 10 hits in 883 CRISPR screens
ChiTaRSⁱ	CDKN2A, human
EvolutionaryTraceⁱ	P42771
GeneWikiⁱ	P16_(gene)
GenomeRNAiⁱ	1029
Pharosⁱ	P42771, Tbio
RNActⁱ	P42771, protein
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000147889, Expressed in adenohypophysis and 208 other tissues
ExpressionAtlasⁱ	P42771, baseline and differential
Genevisibleⁱ	P42771, HS

Family and domain databases

Gene3Dⁱ	1.25.40.20, 1 hit
InterProⁱ	View protein in InterPro IPR020683, Ankyrin_rpt-contain_dom IPR036770, Ankyrin_rpt-contain_sf
SUPFAMⁱ	SSF48403, SSF48403, 1 hit
PROSITEⁱ	View protein in PROSITE PS50297, ANK_REP_REGION, 1 hit
ProtoNetⁱ	Search...
MobiDBⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CDN2A_HUMAN
Accessionⁱ	P42771Primary (citable) accession number: P42771 Secondary accession number(s): A5X2G7 Q9NP05
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1995
	Last sequence update:	July 15, 1998
	Last modified:	August 12, 2020
	This is version 224 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
SIMILARITY comments
Index of protein domains and families
Human chromosome 9
Human chromosome 9: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P42771 (CDN2A_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cyclin-dependent kinase inhibitor 2A

CDKN2A

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Cytosol

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Familial atypical multiple mole melanoma-pancreatic carcinoma syndrome (FAMMMPC)

Keywords - Diseasei

Organism-specific databases

Miscellaneous databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

P42771

GO - Molecular functioni

Protein-protein interaction databases

Miscellaneous databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ