Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P42737 (BCA2_ARATH)

Entry version 160 (16 Oct 2019)
Sequence version 3 (09 Jul 2014)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Beta carbonic anhydrase 2, chloroplastic

Gene

BCA2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Reversible hydration of carbon dioxide. This isoform ensures the supply of bicarbonate for pep carboxylase.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: C4 acid pathway

This protein is involved in the pathway C4 acid pathway, which is part of Photosynthesis.
View all proteins of this organism that are known to be involved in the pathway C4 acid pathway and in Photosynthesis.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase
LigandZinc

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00322

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Beta carbonic anhydrase 2, chloroplastic (EC:4.2.1.1)
Short name:
AtbCA2
Short name:
AtbetaCA2
Alternative name(s):
Beta carbonate dehydratase 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BCA2
Synonyms:CA18, CA2
Ordered Locus Names:At5g14740
ORF Names:T9L3.40
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliopsida › eudicotyledons › Gunneridae › Pentapetalae › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...Araporti		AT5G14740

The Arabidopsis Information Resource

More...TAIRi		locus:2185460 AT5G14740

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Cytoplasm, Plastid

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 71ChloroplastSequence analysisAdd BLAST71
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000007745872 – 331Beta carbonic anhydrase 2, chloroplasticAdd BLAST260
Isoform 2 (identifier: P42737-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei107PhosphothreonineCombined sources1
Modified residuei170PhosphoserineCombined sources1
Modified residuei198PhosphotyrosineCombined sources1
Modified residuei275S-nitrosocysteineBy similarity1
Isoform 2 (identifier: P42737-2)
Modified residuei2N-acetylglycineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein, S-nitrosylation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P42737

PRoteomics IDEntifications database

More...PRIDEi		P42737

2D gel databases

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...SWISS-2DPAGEi		P42737

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P42737

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Strongly expressed in aerial tissues including leaves, stems, flowers and siliques. Accumulates in mesophyll cells.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression reduced by 20% under dark conditions.

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P42737 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P42737 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		16603, 2 interactors

Protein interaction database and analysis system

More...IntActi		P42737, 50 interactors

STRING: functional protein association networks

More...STRINGi		3702.AT5G14740.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P42737

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the beta-class carbonic anhydrase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1578 Eukaryota
COG0288 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000125183

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P42737

KEGG Orthology (KO)

More...KOi		K01673

Identification of Orthologs from Complete Genome Data

More...OMAi		ETAIGPR

Database of Orthologous Groups

More...OrthoDBi		1136193at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.1050.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001765 Carbonic_anhydrase
IPR015892 Carbonic_anhydrase_CS
IPR036874 Carbonic_anhydrase_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00484 Pro_CA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00947 Pro_CA, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53056 SSF53056, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00704 PROK_CO2_ANHYDRASE_1, 1 hit
PS00705 PROK_CO2_ANHYDRASE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. According to EST sequences.

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P42737-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVPFWTTVSR NGSSDSETTL QSASKATKQY KYPSLRPSHR LSLLFLFPFH 
        60         70         80         90        100
LSANGACFRC TCFSHFKLEL RRMGNESYED AIEALKKLLI EKDDLKDVAA 
       110        120        130        140        150
AKVKKITAEL QAASSSDSKS FDPVERIKEG FVTFKKEKYE TNPALYGELA 
       160        170        180        190        200
KGQSPKYMVF ACSDSRVCPS HVLDFHPGDA FVVRNIANMV PPFDKVKYAG 
       210        220        230        240        250
VGAAIEYAVL HLKVENIVVI GHSACGGIKG LMSFPLDGNN STDFIEDWVK 
       260        270        280        290        300
ICLPAKSKVL AESESSAFED QCGRCEREAV NVSLANLLTY PFVREGVVKG 
       310        320        330 
TLALKGGYYD FVNGSFELWE LQFGISPVHS I
Length:331
Mass (Da):36,615
Last modified:July 9, 2014 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i31F5B61B9D262254
GO
Isoform 2 (identifier: P42737-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRM → M

Show »
Length:259
Mass (Da):28,344
Checksum:iE329D4DAEF350CE0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MQY4A8MQY4_ARATH
Carbonic anhydrase
CA2 BETA CA2, BETA CARBONIC ANHYDRASE 2, CA18, CARBONIC ANHYDRASE 18, CARBONIC ANHYDRASE 2
310Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F4K873F4K873_ARATH
Carbonic anhydrase
CA2 BETA CA2, BETA CARBONIC ANHYDRASE 2, CA18, CARBONIC ANHYDRASE 18, CARBONIC ANHYDRASE 2
330Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F4K875F4K875_ARATH
Carbonic anhydrase
CA2 BETA CA2, BETA CARBONIC ANHYDRASE 2, CA18, CARBONIC ANHYDRASE 18, CARBONIC ANHYDRASE 2
330Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA50156 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAG40063 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAG41445 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAN31799 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAN31810 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAC01873 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti109 – 110EL → DV in AAA50156 (PubMed:7520589).Curated2
Sequence conflicti287 – 288LL → RC in AAA50156 (PubMed:7520589).Curated2
Sequence conflicti310D → A in AAA50156 (PubMed:7520589).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0550681 – 73MVPFW…ELRRM → M in isoform 2. 3 PublicationsAdd BLAST73

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL391149 Genomic DNA Translation: CAC01873.1 Sequence problems.
CP002688 Genomic DNA Translation: AED92068.1
CP002688 Genomic DNA Translation: AED92069.1
CP002688 Genomic DNA Translation: ANM68481.1
CP002688 Genomic DNA Translation: ANM68482.1
CP002688 Genomic DNA Translation: ANM68483.1
CP002688 Genomic DNA Translation: ANM68484.1
AF324712 mRNA Translation: AAG40063.1 Different initiation.
AF326863 mRNA Translation: AAG41445.1 Different initiation.
AF339686 mRNA Translation: AAK00368.1
AF428428 mRNA Translation: AAL16197.1
BT000652 mRNA Translation: AAN31799.1 Different initiation.
BT000663 mRNA Translation: AAN31810.1 Different initiation.
AK317585 mRNA Translation: BAH20249.1
L18901 mRNA Translation: AAA50156.1 Different initiation.
Z26538 mRNA Translation: CAA81309.1

NCBI Reference Sequences

More...RefSeqi		NP_001330235.1, NM_001343359.1 [P42737-2]
NP_001330236.1, NM_001343360.1 [P42737-2]
NP_001330237.1, NM_001343361.1 [P42737-2]
NP_001330238.1, NM_001343362.1 [P42737-2]
NP_568303.2, NM_121478.4 [P42737-1]
NP_974782.1, NM_203053.2 [P42737-2]

Genome annotation databases

Ensembl plant genome annotation project

More...EnsemblPlantsi		AT5G14740.1; AT5G14740.1; AT5G14740 [P42737-1]
AT5G14740.2; AT5G14740.2; AT5G14740 [P42737-2]
AT5G14740.6; AT5G14740.6; AT5G14740 [P42737-2]
AT5G14740.7; AT5G14740.7; AT5G14740 [P42737-2]
AT5G14740.8; AT5G14740.8; AT5G14740 [P42737-2]
AT5G14740.9; AT5G14740.9; AT5G14740 [P42737-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		831326

Gramene; a comparative resource for plants

More...Gramenei		AT5G14740.1; AT5G14740.1; AT5G14740 [P42737-1]
AT5G14740.2; AT5G14740.2; AT5G14740 [P42737-2]
AT5G14740.6; AT5G14740.6; AT5G14740 [P42737-2]
AT5G14740.7; AT5G14740.7; AT5G14740 [P42737-2]
AT5G14740.8; AT5G14740.8; AT5G14740 [P42737-2]
AT5G14740.9; AT5G14740.9; AT5G14740 [P42737-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		ath:AT5G14740

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL391149 Genomic DNA Translation: CAC01873.1 Sequence problems.
CP002688 Genomic DNA Translation: AED92068.1
CP002688 Genomic DNA Translation: AED92069.1
CP002688 Genomic DNA Translation: ANM68481.1
CP002688 Genomic DNA Translation: ANM68482.1
CP002688 Genomic DNA Translation: ANM68483.1
CP002688 Genomic DNA Translation: ANM68484.1
AF324712 mRNA Translation: AAG40063.1 Different initiation.
AF326863 mRNA Translation: AAG41445.1 Different initiation.
AF339686 mRNA Translation: AAK00368.1
AF428428 mRNA Translation: AAL16197.1
BT000652 mRNA Translation: AAN31799.1 Different initiation.
BT000663 mRNA Translation: AAN31810.1 Different initiation.
AK317585 mRNA Translation: BAH20249.1
L18901 mRNA Translation: AAA50156.1 Different initiation.
Z26538 mRNA Translation: CAA81309.1
RefSeqiNP_001330235.1, NM_001343359.1 [P42737-2]
NP_001330236.1, NM_001343360.1 [P42737-2]
NP_001330237.1, NM_001343361.1 [P42737-2]
NP_001330238.1, NM_001343362.1 [P42737-2]
NP_568303.2, NM_121478.4 [P42737-1]
NP_974782.1, NM_203053.2 [P42737-2]

3D structure databases

SMRiP42737
ModBaseiSearch...

Protein-protein interaction databases

BioGridi16603, 2 interactors
IntActiP42737, 50 interactors
STRINGi3702.AT5G14740.1

PTM databases

iPTMnetiP42737

2D gel databases

SWISS-2DPAGEiP42737

Proteomic databases

PaxDbiP42737
PRIDEiP42737

Genome annotation databases

EnsemblPlantsiAT5G14740.1; AT5G14740.1; AT5G14740 [P42737-1]
AT5G14740.2; AT5G14740.2; AT5G14740 [P42737-2]
AT5G14740.6; AT5G14740.6; AT5G14740 [P42737-2]
AT5G14740.7; AT5G14740.7; AT5G14740 [P42737-2]
AT5G14740.8; AT5G14740.8; AT5G14740 [P42737-2]
AT5G14740.9; AT5G14740.9; AT5G14740 [P42737-2]
GeneIDi831326
GrameneiAT5G14740.1; AT5G14740.1; AT5G14740 [P42737-1]
AT5G14740.2; AT5G14740.2; AT5G14740 [P42737-2]
AT5G14740.6; AT5G14740.6; AT5G14740 [P42737-2]
AT5G14740.7; AT5G14740.7; AT5G14740 [P42737-2]
AT5G14740.8; AT5G14740.8; AT5G14740 [P42737-2]
AT5G14740.9; AT5G14740.9; AT5G14740 [P42737-2]
KEGGiath:AT5G14740

Organism-specific databases

AraportiAT5G14740
TAIRilocus:2185460 AT5G14740

Phylogenomic databases

eggNOGiKOG1578 Eukaryota
COG0288 LUCA
HOGENOMiHOG000125183
InParanoidiP42737
KOiK01673
OMAiETAIGPR
OrthoDBi1136193at2759

Enzyme and pathway databases

UniPathwayiUPA00322

Miscellaneous databases

Protein Ontology

More...PROi		PR:P42737

Gene expression databases

ExpressionAtlasiP42737 baseline and differential
GenevisibleiP42737 AT

Family and domain databases

Gene3Di3.40.1050.10, 1 hit
InterProiView protein in InterPro
IPR001765 Carbonic_anhydrase
IPR015892 Carbonic_anhydrase_CS
IPR036874 Carbonic_anhydrase_sf
PfamiView protein in Pfam
PF00484 Pro_CA, 1 hit
SMARTiView protein in SMART
SM00947 Pro_CA, 1 hit
SUPFAMiSSF53056 SSF53056, 1 hit
PROSITEiView protein in PROSITE
PS00704 PROK_CO2_ANHYDRASE_1, 1 hit
PS00705 PROK_CO2_ANHYDRASE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBCA2_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P42737
Secondary accession number(s): B9DHN2
, F4K874, Q42116, Q9FDZ0, Q9LER2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: July 9, 2014
Last modified: October 16, 2019
This is version 160 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again