Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - P42567 (EPS15_MOUSE)

Entry version 203 (23 Feb 2022)
Sequence version 1 (01 Nov 1995)
Previous versions | rss
Add a publicationFeedback
Protein

Epidermal growth factor receptor substrate 15

Gene

Eps15

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in cell growth regulation. May be involved in the regulation of mitogenic signals and control of cell proliferation. Involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) type, in particular EGFR. Plays a role in the assembly of clathrin-coated pits (CCPs). Acts as a clathrin adapter required for post-Golgi trafficking. Seems to be involved in CCPs maturation including invagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi173Calcium 1PROSITE-ProRule annotation1
Metal bindingi175Calcium 1PROSITE-ProRule annotation1
Metal bindingi177Calcium 1PROSITE-ProRule annotation1
Metal bindingi179Calcium 1PROSITE-ProRule annotation1
Metal bindingi184Calcium 1PROSITE-ProRule annotation1
Metal bindingi236Calcium 2PROSITE-ProRule annotation1
Metal bindingi238Calcium 2PROSITE-ProRule annotation1
Metal bindingi240Calcium 2PROSITE-ProRule annotation1
Metal bindingi242Calcium 2PROSITE-ProRule annotation1
Metal bindingi247Calcium 2PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis, Protein transport, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-182971, EGFR downregulation
R-MMU-6807004, Negative regulation of MET activity
R-MMU-8856825, Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828, Clathrin-mediated endocytosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Epidermal growth factor receptor substrate 15
Short name:
Protein Eps15
Alternative name(s):
Protein AF-1p
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Eps15
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:104583, Eps15

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000028552

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Coated pit, Cytoplasm, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi850Y → F: Inefficient EGFR internalization. 1 Publication1
Mutagenesisi863E → A: Loss of interaction with UBQLN1; when associated with A-864 and A-865. 1 Publication1
Mutagenesisi864S → A: Loss of interaction with UBQLN1; when associated with A-863 and A-865. 1 Publication1
Mutagenesisi865E → A: Loss of interaction with UBQLN1; when associated with A-863 and A-864. 1 Publication1
Mutagenesisi883L → A: Loss of ubiquitination and interaction with UBQLN1; when associated with A-885. 1 Publication1
Mutagenesisi885L → A: Loss of ubiquitination and interaction with UBQLN1; when associated with A-883. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001461172 – 897Epidermal growth factor receptor substrate 15Add BLAST896

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei108PhosphoserineBy similarity1
Modified residuei140PhosphoserineCombined sources1
Modified residuei321PhosphothreonineCombined sources1
Modified residuei323PhosphoserineBy similarity1
Modified residuei324PhosphoserineCombined sources1
Modified residuei467PhosphoserineBy similarity1
Modified residuei470PhosphoserineBy similarity1
Modified residuei485PhosphoserineBy similarity1
Modified residuei561PhosphoserineCombined sources1
Modified residuei562PhosphoserineCombined sources1
Modified residuei748PhosphoserineBy similarity1
Modified residuei779PhosphothreonineCombined sources1
Modified residuei781PhosphothreonineCombined sources1
Modified residuei798PhosphoserineBy similarity1
Modified residuei816PhosphoserineCombined sources1
Modified residuei850Phosphotyrosine; by EGFR1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylation on Tyr-850 is involved in the internalization of EGFR. Not required for membrane translocation after EGF treatment or for targeting to coated pits, but essential for a subsequent step in EGFR endocytosis.By similarity1 Publication
Ubiquitinated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P42567

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P42567

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P42567

PeptideAtlas

More...PeptideAtlasi		P42567

PRoteomics IDEntifications database

More...PRIDEi		P42567

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		275463 [P42567-1]
275464 [P42567-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P42567

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P42567

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000028552, Expressed in dentate gyrus of hippocampal formation and 319 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P42567, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P42567, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HGS; the interaction bridges the interaction of STAM or STAM2 with EPS15.

Isoform 2 interacts with HGS and AP2A2.

Part of a complex at least composed of EPS15, HGS, and either STAM or STAM2. Binds AP2A2.

Interacts with AP2B1; clathrin competes with EPS15. Binds STON2.

Interacts (via its SH3-binding sites) with CRK.

Interacts with SH3BP4/TTP.

Interacts with ERBB2.

Interacts (via UIM repeats) with CORO7 (when ubiquitinated at 'Lys-472') (By similarity).

Interacts with FCHO1 (By similarity).

Interacts with FCHO2.

Interacts with SGIP1.

Interacts (via EH domains) with DAB2.

Interacts (via UIM domains) with UBQLN1 (via ubiquitin-like domain) and can interact with both the ubiquitinated and the non-ubiquitinated forms of UBQLN1.

Interacts with UBQLN2 (By similarity).

Interacts with REPS2; the interaction is direct (PubMed:10393179).

Interacts with EPN1; the interaction is direct (By similarity).

By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		199489, 49 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P42567

Database of interacting proteins

More...DIPi		DIP-29052N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P42567

Protein interaction database and analysis system

More...IntActi		P42567, 9 interactors

Molecular INTeraction database

More...MINTi		P42567

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000099790

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P42567, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1897
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P42567

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P42567

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini15 – 104EH 1PROSITE-ProRule annotationAdd BLAST90
Domaini48 – 83EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini128 – 216EH 2PROSITE-ProRule annotationAdd BLAST89
Domaini160 – 195EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini223 – 258EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini224 – 314EH 3PROSITE-ProRule annotationAdd BLAST91
Domaini262 – 292EF-hand 4PROSITE-ProRule annotationAdd BLAST31
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati599 – 60113
Repeati623 – 62523
Repeati629 – 63133
Repeati634 – 63643
Repeati640 – 64253
Repeati645 – 64763
Repeati651 – 65373
Repeati665 – 66783
Repeati673 – 67593
Repeati693 – 695103
Repeati711 – 713113
Repeati806 – 808123
Repeati827 – 829133
Domaini852 – 871UIM 1PROSITE-ProRule annotationAdd BLAST20
Domaini878 – 897UIM 2PROSITE-ProRule annotationAdd BLAST20

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 330Interaction with DAB21 PublicationAdd BLAST329
Regioni528 – 607DisorderedSequence analysisAdd BLAST80
Regioni599 – 82913 X 3 AA repeats of D-P-FAdd BLAST231
Regioni667 – 692DisorderedSequence analysisAdd BLAST26
Regioni741 – 849DisorderedSequence analysisAdd BLAST109

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi528 – 568Polar residuesSequence analysisAdd BLAST41
Compositional biasi585 – 603Basic and acidic residuesSequence analysisAdd BLAST19
Compositional biasi667 – 690Polar residuesSequence analysisAdd BLAST24
Compositional biasi741 – 757Polar residuesSequence analysisAdd BLAST17
Compositional biasi773 – 792Pro residuesSequence analysisAdd BLAST20
Compositional biasi827 – 849Polar residuesSequence analysisAdd BLAST23

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins.By similarity
The UIM (ubiquitin-interacting motif) repeats specifically bind 'Lys-33'-linked ubiquitin.By similarity

Keywords - Domaini

Repeat, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0998, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155751

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P42567

Database for complete collections of gene phylogenies

More...PhylomeDBi		P42567

TreeFam database of animal gene trees

More...TreeFami		TF324293

Family and domain databases

Conserved Domains Database

More...CDDi		cd00052, EH, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR000261, EH_dom
IPR003903, UIM_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12763, EF-hand_4, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00054, EFh, 4 hits
SM00027, EH, 3 hits
SM00726, UIM, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473, SSF47473, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 4 hits
PS50031, EH, 3 hits
PS50330, UIM, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P42567-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAAQLSLT QLSSGNPVYE KYYRQVEAGN TGRVLALDAA AFLKKSGLPD 
        60         70         80         90        100
LILGKIWDLA DTDGKGVLSK QEFFVALRLV ACAQNGLEVS LSSLSLAVPP 
       110        120        130        140        150
PRFHDSSSPL LTSGPSVAEL PWAVKSEDKA KYDAIFDSLS PVDGFLSGDK 
       160        170        180        190        200
VKPVLLNSKL PVEILGRVWE LSDIDHDGKL DRDEFAVAMF LVYCALEKEP 
       210        220        230        240        250
VPMSLPPALV PPSKRKTWVV SPAEKAKYDE IFLKTDKDMD GYVSGLEVRE 
       260        270        280        290        300
TFLKTGLPSA LLAHIWSLCD TKGCGKLSKD QFALAFHLIN QKLIKGIDPP 
       310        320        330        340        350
HSLTPEMIPP SDRSSLQKNI TGSSPVADFS AIKELDTLNN EIVDLQREKN 
       360        370        380        390        400
NVEQDLKEKE DTVKQRTSEV QDLQDEVQRE SINLQKLQAQ KQQVQELLGE 
       410        420        430        440        450
LDEQKAQLEE QLQEVRKKCA EEAQLISSLK AEITSQESQI SSYEEELLKA 
       460        470        480        490        500
REELSRLQQE TAQLEESVES GKAQLEPLQQ HLQESQQEIS SMQMRLEMKD 
       510        520        530        540        550
LETDNNQSNW SSSPQSVLVN GATDYCSLST SSSETANFNE HAEGQNNLES 
       560        570        580        590        600
EPTHQESSVR SSPEIAPSDV TDESEAVTVA GNEKVTPRFD DDKHSKEEDP 
       610        620        630        640        650
FNVESSSLTD AVADTNLDFF QSDPFVGSDP FKDDPFGKID PFGGDPFKGS 
       660        670        680        690        700
DPFASDCFFK QTSTDPFTTS STDPFSASSN SSNTSVETWK HNDPFAPGGT 
       710        720        730        740        750
VVAAASDSAT DPFASVFGNE SFGDGFADFS TLSKVNNEDA FNPTISSSTS 
       760        770        780        790        800
SVTIAKPMLE ETASKSEDVP PALPPKVGTP TRPCPPPPGK RPINKLDSSD 
       810        820        830        840        850
PLKLNDPFQP FPGNDSPKEK DPDMFCDPFT SSTTTNKEAD PSNFANFSAY 
       860        870        880        890 
PSEEDMIEWA KRESEREEEQ RLARLNQQEQ EDLELAIALS KSEISEA
Length:897
Mass (Da):98,471
Last modified:November 1, 1995 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i08A0C0D423F873C2
GO
Isoform 2 (identifier: P42567-2) [UniParc]FASTAAdd to basket
Also known as: Eps15b

The sequence of this isoform differs from the canonical sequence as follows:
     1-314: Missing.
     315-346: SLQKNITGSSPVADFSAIKELDTLNNEIVDLQ → MYSDSGLGGWIAIPAVADVLRYSCIVCWSS

Show »
Length:581
Mass (Da):64,071
Checksum:i9209CDDDB4446D1C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BK65H3BK65_MOUSE
Epidermal growth factor receptor su...
Eps15
933Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6W2Q5F6W2Q5_MOUSE
Epidermal growth factor receptor su...
Eps15
764Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JC28Q5JC28_MOUSE
Epidermal growth factor receptor pa...
Eps15
793Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J0A0A0A0R4J0A0_MOUSE
Epidermal growth factor receptor su...
Eps15
583Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BLE4H3BLE4_MOUSE
Epidermal growth factor receptor su...
Eps15
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BJB8H3BJB8_MOUSE
Epidermal growth factor receptor su...
Eps15
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0361701 – 314Missing in isoform 2. 1 PublicationAdd BLAST314
Alternative sequenceiVSP_036171315 – 346SLQKN…IVDLQ → MYSDSGLGGWIAIPAVADVL RYSCIVCWSS in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L21768 mRNA Translation: AAA02912.1
AK083176 mRNA Translation: BAC38796.1
AL669905 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS18462.1 [P42567-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A54696

NCBI Reference Sequences

More...RefSeqi		NP_001153436.1, NM_001159964.1
NP_031969.1, NM_007943.3 [P42567-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000102729; ENSMUSP00000099790; ENSMUSG00000028552 [P42567-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		13858

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:13858

UCSC genome browser

More...UCSCi		uc008ucf.2, mouse [P42567-1]
uc008ucg.2, mouse [P42567-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L21768 mRNA Translation: AAA02912.1
AK083176 mRNA Translation: BAC38796.1
AL669905 Genomic DNA No translation available.
CCDSiCCDS18462.1 [P42567-1]
PIRiA54696
RefSeqiNP_001153436.1, NM_001159964.1
NP_031969.1, NM_007943.3 [P42567-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1KYFX-ray1.22P627-632[»]
1KYUX-ray1.80P627-632[»]
1QJTNMR-A7-105[»]
SMRiP42567
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi199489, 49 interactors
CORUMiP42567
DIPiDIP-29052N
ELMiP42567
IntActiP42567, 9 interactors
MINTiP42567
STRINGi10090.ENSMUSP00000099790

PTM databases

iPTMnetiP42567
PhosphoSitePlusiP42567

Proteomic databases

EPDiP42567
jPOSTiP42567
PaxDbiP42567
PeptideAtlasiP42567
PRIDEiP42567
ProteomicsDBi275463 [P42567-1]
275464 [P42567-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1916, 245 antibodies from 31 providers

The DNASU plasmid repository

More...DNASUi		13858

Genome annotation databases

EnsembliENSMUST00000102729; ENSMUSP00000099790; ENSMUSG00000028552 [P42567-1]
GeneIDi13858
KEGGimmu:13858
UCSCiuc008ucf.2, mouse [P42567-1]
uc008ucg.2, mouse [P42567-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2060
MGIiMGI:104583, Eps15
VEuPathDBiHostDB:ENSMUSG00000028552

Phylogenomic databases

eggNOGiKOG0998, Eukaryota
GeneTreeiENSGT00940000155751
InParanoidiP42567
PhylomeDBiP42567
TreeFamiTF324293

Enzyme and pathway databases

ReactomeiR-MMU-182971, EGFR downregulation
R-MMU-6807004, Negative regulation of MET activity
R-MMU-8856825, Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828, Clathrin-mediated endocytosis

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		13858, 0 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Eps15, mouse
EvolutionaryTraceiP42567

Protein Ontology

More...PROi		PR:P42567
RNActiP42567, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000028552, Expressed in dentate gyrus of hippocampal formation and 319 other tissues
ExpressionAtlasiP42567, baseline and differential
GenevisibleiP42567, MM

Family and domain databases

CDDicd00052, EH, 3 hits
InterProiView protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR000261, EH_dom
IPR003903, UIM_dom
PfamiView protein in Pfam
PF12763, EF-hand_4, 3 hits
SMARTiView protein in SMART
SM00054, EFh, 4 hits
SM00027, EH, 3 hits
SM00726, UIM, 2 hits
SUPFAMiSSF47473, SSF47473, 3 hits
PROSITEiView protein in PROSITE
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 4 hits
PS50031, EH, 3 hits
PS50330, UIM, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEPS15_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P42567
Secondary accession number(s): Q8C431
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: February 23, 2022
This is version 203 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again