Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P42566 (EPS15_HUMAN)

Entry version 223 (29 Sep 2021)
Sequence version 2 (07 Jun 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Epidermal growth factor receptor substrate 15

Gene

EPS15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in cell growth regulation. May be involved in the regulation of mitogenic signals and control of cell proliferation. Involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) type, in particular EGFR. Plays a role in the assembly of clathrin-coated pits (CCPs). Acts as a clathrin adapter required for post-Golgi trafficking. Seems to be involved in CCPs maturation including invagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2.

4 Publications

Caution

Studies in clathrin-mediated endocytosis of ITGB1 and TFR used a siRNA mixture of EPS15 and EPS15L1, and a Dab2 mutant with impaired binding to EH domain-containing proteins EPS15 and ITSN1 suggesting a partially overlapping role of the EH domain-containing proteins.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi173 – 1841Add BLAST12
Calcium bindingi236 – 2472Add BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis, Host-virus interaction, Protein transport, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P42566

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-182971, EGFR downregulation
R-HSA-6807004, Negative regulation of MET activity
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis
R-HSA-8875360, InlB-mediated entry of Listeria monocytogenes into host cell

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P42566

SIGNOR Signaling Network Open Resource

More...SIGNORi		P42566

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		P42566, Curated

MoonProt database of moonlighting proteins

More...MoonProti		P42566

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Epidermal growth factor receptor substrate 15
Short name:
Protein Eps15
Alternative name(s):
Protein AF-1p
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EPS15
Synonyms:AF1P
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:3419, EPS15

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600051, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P42566

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000085832

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Coated pit, Cytoplasm, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving EPS15 is found in acute leukemias. Translocation t(1;11)(p32;q23) with KMT2A/MLL1. The result is a rogue activator protein.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi154V → E: Loss of interaction with STON2 NPF motifs. 1 Publication1
Mutagenesisi169W → A: Loss of interaction with STON2 NPF motifs. 1 Publication1

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...DisGeNETi		2060

Open Targets

More...OpenTargetsi		ENSG00000085832

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27838

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P42566, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4295760

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		EPS15

Domain mapping of disease mutations (DMDM)

More...DMDMi		67476728

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001461162 – 896Epidermal growth factor receptor substrate 15Add BLAST895

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei108PhosphoserineCombined sources1
Modified residuei140PhosphoserineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei324PhosphoserineCombined sources1
Modified residuei467PhosphoserineCombined sources1
Modified residuei470PhosphoserineCombined sources1
Modified residuei485PhosphoserineCombined sources1
Modified residuei562PhosphoserineBy similarity1
Modified residuei563PhosphoserineBy similarity1
Modified residuei746PhosphoserineCombined sources1
Modified residuei777PhosphothreonineCombined sources1
Modified residuei779PhosphothreonineBy similarity1
Modified residuei790PhosphoserineCombined sources1
Modified residuei796PhosphoserineCombined sources1
Modified residuei814PhosphoserineCombined sources1
Modified residuei849Phosphotyrosine; by EGFRCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation on Tyr-849 is involved in the internalization of EGFR. Not required for membrane translocation after EGF treatment or for targeting to coated pits, but essential for a subsequent step in EGFR endocytosis (By similarity). Phosphorylated on serine upon DNA damage, probably by ATM or ATR.By similarity
Ubiquitinated.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-966
CPTAC-967

Encyclopedia of Proteome Dynamics

More...EPDi		P42566

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P42566

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P42566

MaxQB - The MaxQuant DataBase

More...MaxQBi		P42566

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P42566

PeptideAtlas

More...PeptideAtlasi		P42566

PRoteomics IDEntifications database

More...PRIDEi		P42566

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55515 [P42566-1]
55516 [P42566-2]

2D gel databases

USC-OGP 2-DE database

More...OGPi		P42566

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P42566, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P42566

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P42566

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000085832, Expressed in endothelial cell and 252 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P42566, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P42566, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000085832, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SGIP1 (PubMed:26822536).

Interacts with HGS; the interaction bridges the interaction of STAM or STAM2 with EPS15.

Isoform 2 interacts with HGS and AP2A2.

Part of a complex at least composed of EPS15, HGS, and either STAM or STAM2. Binds AP2A2.

Interacts with AP2B1; clathrin competes with EPS15. Binds STON2.

Interacts (via its SH3-binding sites) with CRK.

Interacts with SH3BP4/TTP.

Interacts with ERBB2.

Interacts with FCHO1.

Interacts with FCHO2.

Interacts (via EH domains) with DAB2.

Interacts (via UIM repeats) with CORO7 (when ubiquitinated at 'Lys-472').

Interacts (via UIM domains) with UBQLN1 (via ubiquitin-like domain) and can interact with both the ubiquitinated and the non-ubiquitinated forms of UBQLN1.

Interacts with UBQLN2 (By similarity) (PubMed:10757979, PubMed:11062555, PubMed:12551915, PubMed:16159959, PubMed:16314522, PubMed:16325581, PubMed:16903783, PubMed:18199683, PubMed:18200045, PubMed:18362181, PubMed:20448150, PubMed:21762413, PubMed:22484487, PubMed:22648170, PubMed:24768539, PubMed:8662907, PubMed:9721102, PubMed:9723620).

Interacts with REPS2; the interaction is direct (PubMed:10393179).

Interacts with EPN1; the interaction is direct (PubMed:9723620, PubMed:10393179).

By similarity20 Publications

(Microbial infection) Interacts with vaccinia virus protein A36.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108374, 176 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P42566

Database of interacting proteins

More...DIPi		DIP-33064N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P42566

Protein interaction database and analysis system

More...IntActi		P42566, 91 interactors

Molecular INTeraction database

More...MINTi		P42566

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000360798

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P42566

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P42566, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1896
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P42566

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P42566

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini15 – 104EH 1PROSITE-ProRule annotationAdd BLAST90
Domaini128 – 216EH 2PROSITE-ProRule annotationAdd BLAST89
Domaini160 – 195EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini223 – 258EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini224 – 314EH 3PROSITE-ProRule annotationAdd BLAST91
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati599 – 60113
Repeati623 – 62523
Repeati629 – 63133
Repeati634 – 63643
Repeati640 – 64253
Repeati645 – 64763
Repeati651 – 65373
Repeati664 – 66683
Repeati672 – 67493
Repeati692 – 694103
Repeati709 – 711113
Repeati737 – 739123
Repeati798 – 800133
Repeati804 – 806143
Repeati825 – 827153
Domaini851 – 870UIM 1PROSITE-ProRule annotationAdd BLAST20
Domaini877 – 896UIM 2PROSITE-ProRule annotationAdd BLAST20

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 330Interaction with DAB2By similarityAdd BLAST329
Regioni542 – 606DisorderedSequence analysisAdd BLAST65
Regioni599 – 82715 X 3 AA repeats of D-P-FAdd BLAST229
Regioni760 – 848DisorderedSequence analysisAdd BLAST89

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi768 – 774SH3-binding7

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi542 – 586Polar residuesSequence analysisAdd BLAST45
Compositional biasi587 – 601Basic and acidic residuesSequence analysisAdd BLAST15
Compositional biasi771 – 785Pro residuesSequence analysisAdd BLAST15
Compositional biasi826 – 848Polar residuesSequence analysisAdd BLAST23

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins.1 Publication
The UIM (ubiquitin-interacting motif) repeats specifically bind 'Lys-33'-linked ubiquitin.2 Publications

Keywords - Domaini

Repeat, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0998, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155751

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P42566

Identification of Orthologs from Complete Genome Data

More...OMAi		NSQLNWC

Database of Orthologous Groups

More...OrthoDBi		597979at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P42566

TreeFam database of animal gene trees

More...TreeFami		TF324293

Family and domain databases

Conserved Domains Database

More...CDDi		cd00052, EH, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR000261, EH_dom
IPR003903, UIM_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12763, EF-hand_4, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00054, EFh, 3 hits
SM00027, EH, 3 hits
SM00726, UIM, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473, SSF47473, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 4 hits
PS50031, EH, 3 hits
PS50330, UIM, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P42566-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAAQLSLT QLSSGNPVYE KYYRQVDTGN TGRVLASDAA AFLKKSGLPD 
        60         70         80         90        100
LILGKIWDLA DTDGKGILNK QEFFVALRLV ACAQNGLEVS LSSLNLAVPP 
       110        120        130        140        150
PRFHDTSSPL LISGTSAAEL PWAVKPEDKA KYDAIFDSLS PVNGFLSGDK 
       160        170        180        190        200
VKPVLLNSKL PVDILGRVWE LSDIDHDGML DRDEFAVAMF LVYCALEKEP 
       210        220        230        240        250
VPMSLPPALV PPSKRKTWVV SPAEKAKYDE IFLKTDKDMD GFVSGLEVRE 
       260        270        280        290        300
IFLKTGLPST LLAHIWSLCD TKDCGKLSKD QFALAFHLIS QKLIKGIDPP 
       310        320        330        340        350
HVLTPEMIPP SDRASLQKNI IGSSPVADFS AIKELDTLNN EIVDLQREKN 
       360        370        380        390        400
NVEQDLKEKE DTIKQRTSEV QDLQDEVQRE NTNLQKLQAQ KQQVQELLDE 
       410        420        430        440        450
LDEQKAQLEE QLKEVRKKCA EEAQLISSLK AELTSQESQI STYEEELAKA 
       460        470        480        490        500
REELSRLQQE TAELEESVES GKAQLEPLQQ HLQDSQQEIS SMQMKLMEMK 
       510        520        530        540        550
DLENHNSQLN WCSSPHSILV NGATDYCSLS TSSSETANLN EHVEGQSNLE 
       560        570        580        590        600
SEPIHQESPA RSSPELLPSG VTDENEVTTA VTEKVCSELD NNRHSKEEDP 
       610        620        630        640        650
FNVDSSSLTG PVADTNLDFF QSDPFVGSDP FKDDPFGKID PFGGDPFKGS 
       660        670        680        690        700
DPFASDCFFR QSTDPFATSS TDPFSAANNS SITSVETLKH NDPFAPGGTV 
       710        720        730        740        750
VAASDSATDP FASVFGNESF GGGFADFSTL SKVNNEDPFR SATSSSVSNV 
       760        770        780        790        800
VITKNVFEET SVKSEDEPPA LPPKIGTPTR PCPLPPGKRS INKLDSPDPF 
       810        820        830        840        850
KLNDPFQPFP GNDSPKEKDP EIFCDPFTSA TTTTNKEADP SNFANFSAYP 
       860        870        880        890 
SEEDMIEWAK RESEREEEQR LARLNQQEQE DLELAIALSK SEISEA
Length:896
Mass (Da):98,656
Last modified:June 7, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1B9FE15B47ABAFF
GO
Isoform 2 (identifier: P42566-2) [UniParc]FASTAAdd to basket
Also known as: Eps15b

The sequence of this isoform differs from the canonical sequence as follows:
     1-314: Missing.
     315-346: SLQKNIIGSSPVADFSAIKELDTLNNEIVDLQ → MYLKSDSGLGGWITIPAVADVLKYSCIVCWSS

Show »
Length:582
Mass (Da):64,376
Checksum:i2A7BACA24604E8CA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AUU8B1AUU8_HUMAN
Epidermal growth factor receptor su...
EPS15
762Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3U1S4R3U1_HUMAN
Epidermal growth factor receptor su...
EPS15
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti446Missing in BX647676 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_016142822I → M1 PublicationCorresponds to variant dbSNP:rs17567Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0361681 – 314Missing in isoform 2. 1 PublicationAdd BLAST314
Alternative sequenceiVSP_036169315 – 346SLQKN…IVDLQ → MYLKSDSGLGGWITIPAVAD VLKYSCIVCWSS in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U07707 mRNA Translation: AAA52101.1
Z29064 mRNA Translation: CAA82305.1
AK313396 mRNA Translation: BAG36194.1
DQ367924 mRNA Translation: ABD34786.1
BX647676 mRNA No translation available.
AC104170 Genomic DNA No translation available.
AL671986 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06823.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS557.1 [P42566-1]

Protein sequence database of the Protein Information Resource

More...PIRi		S43074

NCBI Reference Sequences

More...RefSeqi		NP_001153441.1, NM_001159969.1 [P42566-2]
NP_001972.1, NM_001981.2 [P42566-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000371733; ENSP00000360798; ENSG00000085832 [P42566-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2060

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2060

UCSC genome browser

More...UCSCi		uc001csq.2, human [P42566-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U07707 mRNA Translation: AAA52101.1
Z29064 mRNA Translation: CAA82305.1
AK313396 mRNA Translation: BAG36194.1
DQ367924 mRNA Translation: ABD34786.1
BX647676 mRNA No translation available.
AC104170 Genomic DNA No translation available.
AL671986 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06823.1
CCDSiCCDS557.1 [P42566-1]
PIRiS43074
RefSeqiNP_001153441.1, NM_001159969.1 [P42566-2]
NP_001972.1, NM_001981.2 [P42566-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1C07NMR-A217-311[»]
1EH2NMR-A121-218[»]
1F8HNMR-A121-215[»]
1FF1NMR-A121-215[»]
2IV9X-ray1.90P723-730[»]
2JXCNMR-A121-215[»]
4RH5X-ray1.60B846-854[»]
4RH9X-ray1.60B846-854[»]
4RHGX-ray1.58B846-854[»]
4S0GX-ray1.72B846-854[»]
5AWTX-ray2.70B640-649[»]
5AWUX-ray2.70B645-654[»]
5JP2X-ray2.40E/F615-637[»]
SMRiP42566
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi108374, 176 interactors
CORUMiP42566
DIPiDIP-33064N
ELMiP42566
IntActiP42566, 91 interactors
MINTiP42566
STRINGi9606.ENSP00000360798

Chemistry databases

BindingDBiP42566
ChEMBLiCHEMBL4295760

Protein family/group databases

MoonDBiP42566, Curated
MoonProtiP42566

PTM databases

GlyGeniP42566, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP42566
PhosphoSitePlusiP42566

Genetic variation databases

BioMutaiEPS15
DMDMi67476728

2D gel databases

OGPiP42566

Proteomic databases

CPTACiCPTAC-966
CPTAC-967
EPDiP42566
jPOSTiP42566
MassIVEiP42566
MaxQBiP42566
PaxDbiP42566
PeptideAtlasiP42566
PRIDEiP42566
ProteomicsDBi55515 [P42566-1]
55516 [P42566-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1916, 244 antibodies

The DNASU plasmid repository

More...DNASUi		2060

Genome annotation databases

EnsembliENST00000371733; ENSP00000360798; ENSG00000085832 [P42566-1]
GeneIDi2060
KEGGihsa:2060
UCSCiuc001csq.2, human [P42566-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2060
DisGeNETi2060

GeneCards: human genes, protein and diseases

More...GeneCardsi		EPS15
HGNCiHGNC:3419, EPS15
HPAiENSG00000085832, Low tissue specificity
MIMi600051, gene
neXtProtiNX_P42566
OpenTargetsiENSG00000085832
PharmGKBiPA27838
VEuPathDBiHostDB:ENSG00000085832

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0998, Eukaryota
GeneTreeiENSGT00940000155751
InParanoidiP42566
OMAiNSQLNWC
OrthoDBi597979at2759
PhylomeDBiP42566
TreeFamiTF324293

Enzyme and pathway databases

PathwayCommonsiP42566
ReactomeiR-HSA-182971, EGFR downregulation
R-HSA-6807004, Negative regulation of MET activity
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis
R-HSA-8875360, InlB-mediated entry of Listeria monocytogenes into host cell
SignaLinkiP42566
SIGNORiP42566

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2060, 3 hits in 1017 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		EPS15, human
EvolutionaryTraceiP42566

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		EPS15

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2060
PharosiP42566, Tbio

Protein Ontology

More...PROi		PR:P42566
RNActiP42566, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000085832, Expressed in endothelial cell and 252 other tissues
ExpressionAtlasiP42566, baseline and differential
GenevisibleiP42566, HS

Family and domain databases

CDDicd00052, EH, 3 hits
InterProiView protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR000261, EH_dom
IPR003903, UIM_dom
PfamiView protein in Pfam
PF12763, EF-hand_4, 3 hits
SMARTiView protein in SMART
SM00054, EFh, 3 hits
SM00027, EH, 3 hits
SM00726, UIM, 3 hits
SUPFAMiSSF47473, SSF47473, 3 hits
PROSITEiView protein in PROSITE
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 4 hits
PS50031, EH, 3 hits
PS50330, UIM, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEPS15_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P42566
Secondary accession number(s): B2R8J7, D3DPJ2, Q5SRH4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: June 7, 2005
Last modified: September 29, 2021
This is version 223 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again