Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P42263 (GRIA3_HUMAN)

Protein

Glutamate receptor 3

Gene

GRIA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.1 Publication

Miscellaneous

The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.

Caution

It is uncertain whether Met-1 or Met-7 is the initiator.Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei480GlutamateBy similarity1
Binding sitei515GlutamateBy similarity1
Binding sitei737GlutamateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

  • glutamate receptor signaling pathway Source: ProtInc
View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-399710 Activation of AMPA receptors
R-HSA-399719 Trafficking of AMPA receptors
R-HSA-416993 Trafficking of GluR2-containing AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-8849932 Synaptic adhesion-like molecules

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P42263

Protein family/group databases

Transport Classification Database

More...TCDBi		1.A.10.1.4 the glutamate-gated ion channel (gic) family of neurotransmitter receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glutamate receptor 3
Short name:
GluR-3
Alternative name(s):
AMPA-selective glutamate receptor 3
GluR-C
GluR-K3
Glutamate receptor ionotropic, AMPA 3
Short name:
GluA3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GRIA3
Synonyms:GLUR3, GLURC
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000125675.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:4573 GRIA3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		305915 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P42263

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini29 – 552ExtracellularBy similarityAdd BLAST524
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei553 – 573HelicalBy similarityAdd BLAST21
Topological domaini574 – 602CytoplasmicBy similarityAdd BLAST29
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei603 – 618Helical; Pore-formingBy similarityAdd BLAST16
Intramembranei619 – 621By similarity3
Topological domaini622 – 627CytoplasmicBy similarity6
Transmembranei628 – 648HelicalBy similarityAdd BLAST21
Topological domaini649 – 823ExtracellularBy similarityAdd BLAST175
Transmembranei824 – 844Helical; Name=M4By similarityAdd BLAST21
Topological domaini845 – 894CytoplasmicBy similarityAdd BLAST50

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mental retardation, X-linked 94 (MRX94)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. Intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation, while syndromic mental retardation presents with associated physical, neurological and/or psychiatric manifestations. MRX94 patients have moderate mental retardation. Other variable features are macrocephaly, seizures, myoclonic jerks, autistic behavior, asthenic body habitus, distal muscle weakness and hyporeflexia.
See also OMIM:300699
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043484450R → Q in MRX94. 1 PublicationCorresponds to variant dbSNP:rs368568228Ensembl.1
Natural variantiVAR_043485631R → S in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 PublicationCorresponds to variant dbSNP:rs137852351EnsemblClinVar.1
Natural variantiVAR_043486706M → T in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 PublicationCorresponds to variant dbSNP:rs137852352EnsemblClinVar.1
Natural variantiVAR_043487833G → R in MRX94; reduced receptor expression possibly due to rapid degradation. 1 PublicationCorresponds to variant dbSNP:rs137852350EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...DisGeNETi		2892

MalaCards human disease database

More...MalaCardsi		GRIA3
MIMi300699 phenotype

Open Targets

More...OpenTargetsi		ENSG00000125675

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		364028 X-linked intellectual disability due to GRIA3 mutations

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28968

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3595

Drug and drug target database

More...DrugBanki		DB04599 Aniracetam
DB05047 CX717
DB00898 Ethanol
DB00142 L-Glutamic Acid
DB01356 Lithium
DB04982 Talampanel

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		446

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GRIA3

Domain mapping of disease mutations (DMDM)

More...DMDMi		77416864

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 28Sequence analysisAdd BLAST28
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001153629 – 894Glutamate receptor 3Add BLAST866

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi63N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi91 ↔ 340By similarity
Glycosylationi266N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi380N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi415N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi422N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi621S-palmitoyl cysteineBy similarity1
Disulfide bondi750 ↔ 805By similarity
Lipidationi847S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei877PhosphotyrosineBy similarity1
Modified residuei887PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-621 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-847 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P42263

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P42263

PeptideAtlas

More...PeptideAtlasi		P42263

PRoteomics IDEntifications database

More...PRIDEi		P42263

ProteomicsDB human proteome resource

More...ProteomicsDBi		55501
55502 [P42263-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P42263

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P42263

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P42263

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000125675 Expressed in 147 organ(s), highest expression level in Brodmann (1909) area 23

CleanEx database of gene expression profiles

More...CleanExi		HS_GRIA3

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P42263 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P42263 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA058659

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers. Interacts with PRKCABP, GRIP1 and GRIP2 (By similarity). Found in a complex with GRIA1, GRIA2, GRIA4, CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Interacts with CACNG5 (By similarity).By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		109149, 21 interactors

Database of interacting proteins

More...DIPi		DIP-46195N

Protein interaction database and analysis system

More...IntActi		P42263, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000264357

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P42263

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P42263

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P42263

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni508 – 510Glutamate bindingBy similarity3
Regioni686 – 687Glutamate bindingBy similarity2

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The M4 transmembrane segment mediates tetramerization and is required for cell surface expression.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA3 subfamily. [View classification]Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1054 Eukaryota
ENOG410XPSH LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156123

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG051839

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P42263

KEGG Orthology (KO)

More...KOi		K05199

Identification of Orthologs from Complete Genome Data

More...OMAi		VEFFCRS

Database of Orthologous Groups

More...OrthoDBi		EOG091G11CB

Database for complete collections of gene phylogenies

More...PhylomeDBi		P42263

TreeFam database of animal gene trees

More...TreeFami		TF315232

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001828 ANF_lig-bd_rcpt
IPR019594 Glu/Gly-bd
IPR001508 Iono_rcpt_met
IPR001320 Iontro_rcpt
IPR028082 Peripla_BP_I

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01094 ANF_receptor, 1 hit
PF00060 Lig_chan, 1 hit
PF10613 Lig_chan-Glu_bd, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00177 NMDARECEPTOR

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00918 Lig_chan-Glu_bd, 1 hit
SM00079 PBPe, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53822 SSF53822, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform Flop (identifier: P42263-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARQKKMGQS VLRAVFFLVL GLLGHSHGGF PNTISIGGLF MRNTVQEHSA 
        60         70         80         90        100
FRFAVQLYNT NQNTTEKPFH LNYHVDHLDS SNSFSVTNAF CSQFSRGVYA 
       110        120        130        140        150
IFGFYDQMSM NTLTSFCGAL HTSFVTPSFP TDADVQFVIQ MRPALKGAIL 
       160        170        180        190        200
SLLGHYKWEK FVYLYDTERG FSILQAIMEA AVQNNWQVTA RSVGNIKDVQ 
       210        220        230        240        250
EFRRIIEEMD RRQEKRYLID CEVERINTIL EQVVILGKHS RGYHYMLANL 
       260        270        280        290        300
GFTDILLERV MHGGANITGF QIVNNENPMV QQFIQRWVRL DEREFPEAKN 
       310        320        330        340        350
APLKYTSALT HDAILVIAEA FRYLRRQRVD VSRRGSAGDC LANPAVPWSQ 
       360        370        380        390        400
GIDIERALKM VQVQGMTGNI QFDTYGRRTN YTIDVYEMKV SGSRKAGYWN 
       410        420        430        440        450
EYERFVPFSD QQISNDSASS ENRTIVVTTI LESPYVMYKK NHEQLEGNER 
       460        470        480        490        500
YEGYCVDLAY EIAKHVRIKY KLSIVGDGKY GARDPETKIW NGMVGELVYG 
       510        520        530        540        550
RADIAVAPLT ITLVREEVID FSKPFMSLGI SIMIKKPQKS KPGVFSFLDP 
       560        570        580        590        600
LAYEIWMCIV FAYIGVSVVL FLVSRFSPYE WHLEDNNEEP RDPQSPPDPP 
       610        620        630        640        650
NEFGIFNSLW FSLGAFMQQG CDISPRSLSG RIVGGVWWFF TLIIISSYTA 
       660        670        680        690        700
NLAAFLTVER MVSPIESAED LAKQTEIAYG TLDSGSTKEF FRRSKIAVYE 
       710        720        730        740        750
KMWSYMKSAE PSVFTKTTAD GVARVRKSKG KFAFLLESTM NEYIEQRKPC 
       760        770        780        790        800
DTMKVGGNLD SKGYGVATPK GSALRNAVNL AVLKLNEQGL LDKLKNKWWY 
       810        820        830        840        850
DKGECGSGGG DSKDKTSALS LSNVAGVFYI LVGGLGLAMM VALIEFCYKS 
       860        870        880        890 
RAESKRMKLT KNTQNFKPAP ATNTQNYATY REGYNVYGTE SVKI
Length:894
Mass (Da):101,157
Last modified:October 11, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i178589A870E0D102
GO
Isoform Flip (identifier: P42263-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     776-811: NAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → TPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSG

Show »
Length:894
Mass (Da):101,228
Checksum:iEB3ED4EBBA353021
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WYJ6A0A087WYJ6_HUMAN
Glutamate receptor 3
GRIA3
824Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5XKG2Q5XKG2_HUMAN
Glutamate receptor 3
GRIA3
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti195N → H in AAF61847 (PubMed:10644433).Curated1
Sequence conflicti775R → G in AAA67922 (PubMed:7918660).Curated1
Sequence conflicti775R → G in AAA67923 (PubMed:7918660).Curated1
Sequence conflicti775R → G in CAA57567 (Ref. 2) Curated1
Sequence conflicti775R → G in AAF61847 (PubMed:10644433).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043484450R → Q in MRX94. 1 PublicationCorresponds to variant dbSNP:rs368568228Ensembl.1
Natural variantiVAR_023579525F → L3 PublicationsCorresponds to variant dbSNP:rs1052538Ensembl.1
Natural variantiVAR_043485631R → S in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 PublicationCorresponds to variant dbSNP:rs137852351EnsemblClinVar.1
Natural variantiVAR_043486706M → T in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 PublicationCorresponds to variant dbSNP:rs137852352EnsemblClinVar.1
Natural variantiVAR_043487833G → R in MRX94; reduced receptor expression possibly due to rapid degradation. 1 PublicationCorresponds to variant dbSNP:rs137852350EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053351776 – 811NAVNL…SGGGD → TPVNLAVLKLSEQGILDKLK NKWWYDKGECGAKDSG in isoform Flip. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U10302 mRNA Translation: AAA67923.1
U10301 mRNA Translation: AAA67922.1
X82068 mRNA Translation: CAA57567.1
AF159277
, AF159262, AF159263, AF159264, AF159265, AF159266, AF159267, AF159268, AF159269, AF159270, AF159271, AF159272, AF159273, AF159274, AF159275 Genomic DNA Translation: AAF61847.1
AF166365
, AF166362, AF166363, AF166364 Genomic DNA Translation: AAF97857.1
AF167332
, AF166366, AF166367, AF166368, AF166369, AF166370, AF166371, AF166372, AF166373, AF166375 Genomic DNA Translation: AAF97858.1
AF167332
, AF166366, AF166367, AF166368, AF166369, AF166370, AF166371, AF166372, AF166373, AF166374 Genomic DNA Translation: AAF97859.1
AL356213 Genomic DNA No translation available.
AL590139 Genomic DNA No translation available.
Z83848 Genomic DNA No translation available.
Z82899 Genomic DNA No translation available.
AL035426 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11865.1
CH471107 Genomic DNA Translation: EAX11867.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14604.1 [P42263-1]
CCDS14605.1 [P42263-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S49460
S50128
S53696

NCBI Reference Sequences

More...RefSeqi		NP_000819.3, NM_000828.4
NP_015564.4, NM_007325.4

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.377070

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000541091; ENSP00000446440; ENSG00000125675 [P42263-1]
ENST00000620443; ENSP00000478489; ENSG00000125675 [P42263-2]
ENST00000622768; ENSP00000481554; ENSG00000125675 [P42263-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2892

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2892

UCSC genome browser

More...UCSCi		uc033etl.2 human [P42263-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10302 mRNA Translation: AAA67923.1
U10301 mRNA Translation: AAA67922.1
X82068 mRNA Translation: CAA57567.1
AF159277
, AF159262, AF159263, AF159264, AF159265, AF159266, AF159267, AF159268, AF159269, AF159270, AF159271, AF159272, AF159273, AF159274, AF159275 Genomic DNA Translation: AAF61847.1
AF166365
, AF166362, AF166363, AF166364 Genomic DNA Translation: AAF97857.1
AF167332
, AF166366, AF166367, AF166368, AF166369, AF166370, AF166371, AF166372, AF166373, AF166375 Genomic DNA Translation: AAF97858.1
AF167332
, AF166366, AF166367, AF166368, AF166369, AF166370, AF166371, AF166372, AF166373, AF166374 Genomic DNA Translation: AAF97859.1
AL356213 Genomic DNA No translation available.
AL590139 Genomic DNA No translation available.
Z83848 Genomic DNA No translation available.
Z82899 Genomic DNA No translation available.
AL035426 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11865.1
CH471107 Genomic DNA Translation: EAX11867.1
CCDSiCCDS14604.1 [P42263-1]
CCDS14605.1 [P42263-2]
PIRiS49460
S50128
S53696
RefSeqiNP_000819.3, NM_000828.4
NP_015564.4, NM_007325.4
UniGeneiHs.377070

3D structure databases

ProteinModelPortaliP42263
SMRiP42263
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109149, 21 interactors
DIPiDIP-46195N
IntActiP42263, 1 interactor
STRINGi9606.ENSP00000264357

Chemistry databases

BindingDBiP42263
ChEMBLiCHEMBL3595
DrugBankiDB04599 Aniracetam
DB05047 CX717
DB00898 Ethanol
DB00142 L-Glutamic Acid
DB01356 Lithium
DB04982 Talampanel
GuidetoPHARMACOLOGYi446

Protein family/group databases

TCDBi1.A.10.1.4 the glutamate-gated ion channel (gic) family of neurotransmitter receptors

PTM databases

iPTMnetiP42263
PhosphoSitePlusiP42263
SwissPalmiP42263

Polymorphism and mutation databases

BioMutaiGRIA3
DMDMi77416864

Proteomic databases

EPDiP42263
PaxDbiP42263
PeptideAtlasiP42263
PRIDEiP42263
ProteomicsDBi55501
55502 [P42263-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		2892
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000541091; ENSP00000446440; ENSG00000125675 [P42263-1]
ENST00000620443; ENSP00000478489; ENSG00000125675 [P42263-2]
ENST00000622768; ENSP00000481554; ENSG00000125675 [P42263-1]
GeneIDi2892
KEGGihsa:2892
UCSCiuc033etl.2 human [P42263-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2892
DisGeNETi2892
EuPathDBiHostDB:ENSG00000125675.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		GRIA3
HGNCiHGNC:4573 GRIA3
HPAiHPA058659
MalaCardsiGRIA3
MIMi300699 phenotype
305915 gene
neXtProtiNX_P42263
OpenTargetsiENSG00000125675
Orphaneti364028 X-linked intellectual disability due to GRIA3 mutations
PharmGKBiPA28968

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1054 Eukaryota
ENOG410XPSH LUCA
GeneTreeiENSGT00940000156123
HOVERGENiHBG051839
InParanoidiP42263
KOiK05199
OMAiVEFFCRS
OrthoDBiEOG091G11CB
PhylomeDBiP42263
TreeFamiTF315232

Enzyme and pathway databases

ReactomeiR-HSA-399710 Activation of AMPA receptors
R-HSA-399719 Trafficking of AMPA receptors
R-HSA-416993 Trafficking of GluR2-containing AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-8849932 Synaptic adhesion-like molecules
SignaLinkiP42263

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GRIA3 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		GRIA3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2892

Protein Ontology

More...PROi		PR:P42263

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000125675 Expressed in 147 organ(s), highest expression level in Brodmann (1909) area 23
CleanExiHS_GRIA3
ExpressionAtlasiP42263 baseline and differential
GenevisibleiP42263 HS

Family and domain databases

InterProiView protein in InterPro
IPR001828 ANF_lig-bd_rcpt
IPR019594 Glu/Gly-bd
IPR001508 Iono_rcpt_met
IPR001320 Iontro_rcpt
IPR028082 Peripla_BP_I
PfamiView protein in Pfam
PF01094 ANF_receptor, 1 hit
PF00060 Lig_chan, 1 hit
PF10613 Lig_chan-Glu_bd, 1 hit
PRINTSiPR00177 NMDARECEPTOR
SMARTiView protein in SMART
SM00918 Lig_chan-Glu_bd, 1 hit
SM00079 PBPe, 1 hit
SUPFAMiSSF53822 SSF53822, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGRIA3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P42263
Secondary accession number(s): D3DTF1
, Q4VXD5, Q4VXD6, Q9HDA0, Q9HDA1, Q9HDA2, Q9P0H1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: October 11, 2005
Last modified: December 5, 2018
This is version 186 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again