Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 206 (16 Oct 2019)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Glutamate receptor 1

Gene

GRIA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.2 Publications

Miscellaneous

The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei464GlutamateBy similarity1
Binding sitei499GlutamateBy similarity1
Binding sitei719GlutamateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-204005 COPII-mediated vesicle transport
R-HSA-399710 Activation of AMPA receptors
R-HSA-399719 Trafficking of AMPA receptors
R-HSA-416993 Trafficking of GluR2-containing AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-5694530 Cargo concentration in the ER
R-HSA-8849932 Synaptic adhesion-like molecules
R-HSA-9620244 Long-term potentiation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P42261

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P42261

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.10.1.23 the glutamate-gated ion channel (gic) family of neurotransmitter receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glutamate receptor 1
Short name:
GluR-1
Alternative name(s):
AMPA-selective glutamate receptor 1
GluR-A
GluR-K1
Glutamate receptor ionotropic, AMPA 1
Short name:
GluA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GRIA1
Synonyms:GLUH1, GLUR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4571 GRIA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
138248 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P42261

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini19 – 536ExtracellularBy similarityAdd BLAST518
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei537 – 557HelicalBy similarityAdd BLAST21
Topological domaini558 – 584CytoplasmicBy similarityAdd BLAST27
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei585 – 600Helical; Pore-formingBy similarityAdd BLAST16
Intramembranei601 – 603By similarity3
Topological domaini604 – 609CytoplasmicBy similarity6
Transmembranei610 – 630HelicalBy similarityAdd BLAST21
Topological domaini631 – 805ExtracellularBy similarityAdd BLAST175
Transmembranei806 – 826Helical; Name=M4Add BLAST21
Topological domaini827 – 906CytoplasmicBy similarityAdd BLAST80

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum, Endosome, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
2890

Open Targets

More...
OpenTargetsi
ENSG00000155511

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28966

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P42261

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2009

Drug and drug target database

More...
DrugBanki
DB06247 CX516
DB05047 CX717
DB01189 Desflurane
DB00228 Enflurane
DB00898 Ethanol
DB13146 Fluciclovine (18F)
DB00142 Glutamic Acid
DB00753 Isoflurane
DB01028 Methoxyflurane
DB08883 Perampanel
DB01236 Sevoflurane
DB04982 Talampanel
DB09289 Tianeptine
DB00273 Topiramate

DrugCentral

More...
DrugCentrali
P42261

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
444

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GRIA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242505

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Sequence analysisAdd BLAST18
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001152919 – 906Glutamate receptor 1Add BLAST888

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi63N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi75 ↔ 323By similarity
Glycosylationi249N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi257N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi363N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi401N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi406N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi603S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei645PhosphoserineBy similarity1
Modified residuei710PhosphoserineBy similarity1
Disulfide bondi732 ↔ 787By similarity
Lipidationi829S-palmitoyl cysteineBy similarity1
Modified residuei849PhosphoserineBy similarity1
Modified residuei863PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis (By similarity).By similarity
Phosphorylated at Ser-645. Phosphorylated at Ser-710 by PKC. Phosphorylated at Ser-849 by PKC, PKA and CAMK2. Phosphorylated at Ser-863 by PKC, PKA and PRKG2 (By similarity). Phosphorylation of Ser-863 is reduced by induction of long-term depression and increased by induction of long-term potentiation (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P42261

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P42261

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P42261

PeptideAtlas

More...
PeptideAtlasi
P42261

PRoteomics IDEntifications database

More...
PRIDEi
P42261

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
18070
55496 [P42261-1]
55497 [P42261-2]
6455
6517
7030

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P42261

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P42261

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P42261

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000155511 Expressed in 129 organ(s), highest expression level in Ammon's horn

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P42261 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB001965
HPA035202

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer or heterotetramer of pore-forming glutamate receptor subunits (By similarity). Tetramers may be formed by the dimerization of dimers (PubMed:23739980).

Interacts with HIP1 and RASGRF2.

Interacts with SYNDIG1 and GRIA2 (By similarity).

Interacts with DLG1 (via C-terminus).

Interacts with LRFN1.

Interacts with PRKG2 (By similarity).

Interacts with CNIH2 and CACNG2 (PubMed:20805473).

Interacts with CACNG5.

Interacts (via C-terminus) with PDLIM4 (via LIM domain); this interaction as well as the interaction of PDLIM4 with alpha-actinin is required for their colocalization in early endosomes.

Found in a complex with GRIA2, GRIA3, GRIA4, CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8 (By similarity).

Interacts with SNX27 (via PDZ domain); the interaction is required for recycling to the plasma membrane when endocytosed and prevent degradation in lysosomes.

Interacts (via PDZ-binding motif) with SHANK3 (via PDZ domain) (By similarity).

Interacts with CACNG3; associates GRIA1 with the adaptor protein complex 4 (AP-4) to target GRIA1 to the somatodendritic compartment of neurons (By similarity).

By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109147, 23 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P42261

Database of interacting proteins

More...
DIPi
DIP-41487N

Protein interaction database and analysis system

More...
IntActi
P42261, 1 interactor

Molecular INTeraction database

More...
MINTi
P42261

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000428994

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P42261

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P42261

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni492 – 494Glutamate bindingBy similarity3
Regioni668 – 669Glutamate bindingBy similarity2

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi903 – 906PDZ-binding4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The M4 transmembrane segment mediates tetramerization and is required for cell surface expression.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1054 Eukaryota
ENOG410XPSH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157342

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234372

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P42261

KEGG Orthology (KO)

More...
KOi
K05197

Identification of Orthologs from Complete Genome Data

More...
OMAi
ESHEYEV

Database of Orthologous Groups

More...
OrthoDBi
188544at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P42261

TreeFam database of animal gene trees

More...
TreeFami
TF315232

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001828 ANF_lig-bd_rcpt
IPR019594 Glu/Gly-bd
IPR001508 Iono_rcpt_met
IPR001320 Iontro_rcpt
IPR028082 Peripla_BP_I

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01094 ANF_receptor, 1 hit
PF00060 Lig_chan, 1 hit
PF10613 Lig_chan-Glu_bd, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00177 NMDARECEPTOR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00918 Lig_chan-Glu_bd, 1 hit
SM00079 PBPe, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53822 SSF53822, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform Flop (identifier: P42261-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQHIFAFFCT GFLGAVVGAN FPNNIQIGGL FPNQQSQEHA AFRFALSQLT
60 70 80 90 100
EPPKLLPQID IVNISDSFEM TYRFCSQFSK GVYAIFGFYE RRTVNMLTSF
110 120 130 140 150
CGALHVCFIT PSFPVDTSNQ FVLQLRPELQ DALISIIDHY KWQKFVYIYD
160 170 180 190 200
ADRGLSVLQK VLDTAAEKNW QVTAVNILTT TEEGYRMLFQ DLEKKKERLV
210 220 230 240 250
VVDCESERLN AILGQIIKLE KNGIGYHYIL ANLGFMDIDL NKFKESGANV
260 270 280 290 300
TGFQLVNYTD TIPAKIMQQW KNSDARDHTR VDWKRPKYTS ALTYDGVKVM
310 320 330 340 350
AEAFQSLRRQ RIDISRRGNA GDCLANPAVP WGQGIDIQRA LQQVRFEGLT
360 370 380 390 400
GNVQFNEKGR RTNYTLHVIE MKHDGIRKIG YWNEDDKFVP AATDAQAGGD
410 420 430 440 450
NSSVQNRTYI VTTILEDPYV MLKKNANQFE GNDRYEGYCV ELAAEIAKHV
460 470 480 490 500
GYSYRLEIVS DGKYGARDPD TKAWNGMVGE LVYGRADVAV APLTITLVRE
510 520 530 540 550
EVIDFSKPFM SLGISIMIKK PQKSKPGVFS FLDPLAYEIW MCIVFAYIGV
560 570 580 590 600
SVVLFLVSRF SPYEWHSEEF EEGRDQTTSD QSNEFGIFNS LWFSLGAFMQ
610 620 630 640 650
QGCDISPRSL SGRIVGGVWW FFTLIIISSY TANLAAFLTV ERMVSPIESA
660 670 680 690 700
EDLAKQTEIA YGTLEAGSTK EFFRRSKIAV FEKMWTYMKS AEPSVFVRTT
710 720 730 740 750
EEGMIRVRKS KGKYAYLLES TMNEYIEQRK PCDTMKVGGN LDSKGYGIAT
760 770 780 790 800
PKGSALRNPV NLAVLKLNEQ GLLDKLKNKW WYDKGECGSG GGDSKDKTSA
810 820 830 840 850
LSLSNVAGVF YILIGGLGLA MLVALIEFCY KSRSESKRMK GFCLIPQQSI
860 870 880 890 900
NEAIRTSTLP RNSGAGASSG GSGENGRVVS HDFPKSMQSI PCMSHSSGMP

LGATGL
Length:906
Mass (Da):101,506
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i03EA1E026D0A9A2F
GO
Isoform Flip (identifier: P42261-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

Show »
Length:906
Mass (Da):101,482
Checksum:i4C1973DBFE98C979
GO
Isoform 3 (identifier: P42261-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-154: FCSQFSKGVY...FVYIYDADRG → C

Show »
Length:826
Mass (Da):92,172
Checksum:i53F69105FB85CFC9
GO
Isoform 4 (identifier: P42261-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:837
Mass (Da):93,900
Checksum:i54246EAC4BFFB9F0
GO
Isoform 5 (identifier: P42261-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW

Note: No experimental confirmation available.
Show »
Length:916
Mass (Da):102,888
Checksum:iC49F9C13D74EC7E3
GO
Isoform 6 (identifier: P42261-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW
     758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

Note: No experimental confirmation available.
Show »
Length:916
Mass (Da):102,864
Checksum:i8B6CF1CA44DC94B5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti345R → A in CAA41491 (PubMed:1320959).Curated1
Sequence conflicti375G → S in AAA58395 (PubMed:1311100).Curated1
Sequence conflicti738G → E in BAH12004 (PubMed:14702039).Curated1
Sequence conflicti863S → SA in AAA58613 (PubMed:1652753).Curated1
Sequence conflicti865 – 867AGA → TAP in AAA58613 (PubMed:1652753).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_028071487D → N. Corresponds to variant dbSNP:rs13166146Ensembl.1
Natural variantiVAR_028072521P → T. Corresponds to variant dbSNP:rs13166161Ensembl.1
Natural variantiVAR_028073536A → S. Corresponds to variant dbSNP:rs13166438Ensembl.1
Natural variantiVAR_028074548I → M. Corresponds to variant dbSNP:rs13186241Ensembl.1
Natural variantiVAR_028075588F → L. Corresponds to variant dbSNP:rs13186534Ensembl.1
Natural variantiVAR_078689636A → T Found in patient with severe intellectual disability; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs587776937EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451191 – 69Missing in isoform 4. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_0470241 – 28MQHIF…NIQIG → MCCSTHLFQPLQLAGGLEWP WSNLLCFLTPVKLHPEVW in isoform 5 and isoform 6. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_04512074 – 154FCSQF…DADRG → C in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_053349758 – 793NPVNL…SGGGD → GPVNLAVLKLSEQGVLDKLK SKWWYDKGECGSKDSG in isoform Flip and isoform 6. 2 PublicationsAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M64752 mRNA Translation: AAA58613.1
X58633 mRNA Translation: CAA41491.1
M81886 mRNA Translation: AAA58395.1
AK295039 mRNA Translation: BAH11956.1
AK295184 mRNA Translation: BAH12004.1
AK295827 mRNA Translation: BAH12192.1
AK315934 mRNA Translation: BAH14305.1
AC010613 Genomic DNA No translation available.
AC025156 Genomic DNA No translation available.
AC091960 Genomic DNA No translation available.
AC091962 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61649.1
CH471062 Genomic DNA Translation: EAW61650.1
BC111734 mRNA Translation: AAI11735.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4322.1 [P42261-1]
CCDS47318.1 [P42261-2]
CCDS58986.1 [P42261-3]
CCDS58987.1 [P42261-5]
CCDS58988.1 [P42261-6]
CCDS58989.1 [P42261-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A40222
A41273
S25852
S38723

NCBI Reference Sequences

More...
RefSeqi
NP_000818.2, NM_000827.3 [P42261-1]
NP_001107655.1, NM_001114183.1 [P42261-2]
NP_001244948.1, NM_001258019.1 [P42261-3]
NP_001244950.1, NM_001258021.1 [P42261-5]
NP_001244951.1, NM_001258022.1 [P42261-6]
NP_001244952.1, NM_001258023.1 [P42261-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000285900; ENSP00000285900; ENSG00000155511 [P42261-1]
ENST00000340592; ENSP00000339343; ENSG00000155511 [P42261-2]
ENST00000448073; ENSP00000415569; ENSG00000155511 [P42261-6]
ENST00000518142; ENSP00000427920; ENSG00000155511 [P42261-3]
ENST00000518783; ENSP00000428994; ENSG00000155511 [P42261-5]
ENST00000521843; ENSP00000427864; ENSG00000155511 [P42261-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2890

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2890

UCSC genome browser

More...
UCSCi
uc003luy.5 human [P42261-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64752 mRNA Translation: AAA58613.1
X58633 mRNA Translation: CAA41491.1
M81886 mRNA Translation: AAA58395.1
AK295039 mRNA Translation: BAH11956.1
AK295184 mRNA Translation: BAH12004.1
AK295827 mRNA Translation: BAH12192.1
AK315934 mRNA Translation: BAH14305.1
AC010613 Genomic DNA No translation available.
AC025156 Genomic DNA No translation available.
AC091960 Genomic DNA No translation available.
AC091962 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61649.1
CH471062 Genomic DNA Translation: EAW61650.1
BC111734 mRNA Translation: AAI11735.1
CCDSiCCDS4322.1 [P42261-1]
CCDS47318.1 [P42261-2]
CCDS58986.1 [P42261-3]
CCDS58987.1 [P42261-5]
CCDS58988.1 [P42261-6]
CCDS58989.1 [P42261-4]
PIRiA40222
A41273
S25852
S38723
RefSeqiNP_000818.2, NM_000827.3 [P42261-1]
NP_001107655.1, NM_001114183.1 [P42261-2]
NP_001244948.1, NM_001258019.1 [P42261-3]
NP_001244950.1, NM_001258021.1 [P42261-5]
NP_001244951.1, NM_001258022.1 [P42261-6]
NP_001244952.1, NM_001258023.1 [P42261-4]

3D structure databases

SMRiP42261
ModBaseiSearch...

Protein-protein interaction databases

BioGridi109147, 23 interactors
CORUMiP42261
DIPiDIP-41487N
IntActiP42261, 1 interactor
MINTiP42261
STRINGi9606.ENSP00000428994

Chemistry databases

BindingDBiP42261
ChEMBLiCHEMBL2009
DrugBankiDB06247 CX516
DB05047 CX717
DB01189 Desflurane
DB00228 Enflurane
DB00898 Ethanol
DB13146 Fluciclovine (18F)
DB00142 Glutamic Acid
DB00753 Isoflurane
DB01028 Methoxyflurane
DB08883 Perampanel
DB01236 Sevoflurane
DB04982 Talampanel
DB09289 Tianeptine
DB00273 Topiramate
DrugCentraliP42261
GuidetoPHARMACOLOGYi444

Protein family/group databases

TCDBi1.A.10.1.23 the glutamate-gated ion channel (gic) family of neurotransmitter receptors

PTM databases

iPTMnetiP42261
PhosphoSitePlusiP42261
SwissPalmiP42261

Polymorphism and mutation databases

BioMutaiGRIA1
DMDMi116242505

Proteomic databases

jPOSTiP42261
MassIVEiP42261
PaxDbiP42261
PeptideAtlasiP42261
PRIDEiP42261
ProteomicsDBi18070
55496 [P42261-1]
55497 [P42261-2]
6455
6517
7030

Genome annotation databases

EnsembliENST00000285900; ENSP00000285900; ENSG00000155511 [P42261-1]
ENST00000340592; ENSP00000339343; ENSG00000155511 [P42261-2]
ENST00000448073; ENSP00000415569; ENSG00000155511 [P42261-6]
ENST00000518142; ENSP00000427920; ENSG00000155511 [P42261-3]
ENST00000518783; ENSP00000428994; ENSG00000155511 [P42261-5]
ENST00000521843; ENSP00000427864; ENSG00000155511 [P42261-4]
GeneIDi2890
KEGGihsa:2890
UCSCiuc003luy.5 human [P42261-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2890
DisGeNETi2890

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GRIA1
HGNCiHGNC:4571 GRIA1
HPAiCAB001965
HPA035202
MIMi138248 gene
neXtProtiNX_P42261
OpenTargetsiENSG00000155511
PharmGKBiPA28966

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1054 Eukaryota
ENOG410XPSH LUCA
GeneTreeiENSGT00940000157342
HOGENOMiHOG000234372
InParanoidiP42261
KOiK05197
OMAiESHEYEV
OrthoDBi188544at2759
PhylomeDBiP42261
TreeFamiTF315232

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-399710 Activation of AMPA receptors
R-HSA-399719 Trafficking of AMPA receptors
R-HSA-416993 Trafficking of GluR2-containing AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-5694530 Cargo concentration in the ER
R-HSA-8849932 Synaptic adhesion-like molecules
R-HSA-9620244 Long-term potentiation
SignaLinkiP42261
SIGNORiP42261

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GRIA1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GRIA1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2890
PharosiP42261

Protein Ontology

More...
PROi
PR:P42261

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000155511 Expressed in 129 organ(s), highest expression level in Ammon's horn
GenevisibleiP42261 HS

Family and domain databases

InterProiView protein in InterPro
IPR001828 ANF_lig-bd_rcpt
IPR019594 Glu/Gly-bd
IPR001508 Iono_rcpt_met
IPR001320 Iontro_rcpt
IPR028082 Peripla_BP_I
PfamiView protein in Pfam
PF01094 ANF_receptor, 1 hit
PF00060 Lig_chan, 1 hit
PF10613 Lig_chan-Glu_bd, 1 hit
PRINTSiPR00177 NMDARECEPTOR
SMARTiView protein in SMART
SM00918 Lig_chan-Glu_bd, 1 hit
SM00079 PBPe, 1 hit
SUPFAMiSSF53822 SSF53822, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGRIA1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P42261
Secondary accession number(s): B7Z2S0
, B7Z2W8, B7Z3F6, B7Z9G9, D3DQI4, E7ESV8, Q2NKM6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: October 17, 2006
Last modified: October 16, 2019
This is version 206 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again