Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (07 Oct 2020)
Sequence version 2 (10 Apr 2019)
Previous versions | rss
Help videoAdd a publicationFeedback

Folate receptor gamma



Homo sapiens (Human)
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.


It is uncertain whether Met-1 or Met-3 is the initiator.Curated


Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei103FolateBy similarity1
Binding sitei107FolateBy similarity1
Binding sitei196FolateBy similarity1

<p>The <a href="">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • folic acid binding Source: ProtInc
  • signaling receptor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data


Reactome - a knowledgebase of biological pathways and processes

R-HSA-6798695, Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Folate receptor gamma
Short name:
Alternative name(s):
Folate receptor 3
<p>This subsection of the <a href="">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="">Names and taxonomy</a> section is present for entries that are part of a <a href="">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources


Human Gene Nomenclature Database

HGNC:3795, FOLR3

Online Mendelian Inheritance in Man (OMIM)

602469, gene

neXtProt; the human protein knowledge platform


<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti


<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases



Open Targets


The Pharmacogenetics and Pharmacogenomics Knowledge Base


Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

P41439, Tbio

Chemistry databases

Drug and drug target database

DB00158, Folic acid
DB05168, Vintafolide

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database


Domain mapping of disease mutations (DMDM)


<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000881023 – 245Folate receptor gammaAdd BLAST223

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi37 ↔ 65By similarity
Disulfide bondi57 ↔ 105By similarity
Disulfide bondi66 ↔ 109By similarity
Disulfide bondi89 ↔ 175By similarity
Disulfide bondi96 ↔ 146By similarity
<p>This subsection of the <a href="">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi121N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi135 ↔ 209By similarity
Disulfide bondi139 ↔ 189By similarity
Disulfide bondi152 ↔ 169By similarity
Glycosylationi161N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi201N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database


MassIVE - Mass Spectrometry Interactive Virtual Environment


MaxQB - The MaxQuant DataBase


PaxDb, a database of protein abundance averages across all three domains of life




PRoteomics IDEntifications database


ProteomicsDB: a multi-organism proteome resource

55460 [P41439-1]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

P41439, 3 sites

iPTMnet integrated resource for PTMs in systems biology context


Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.


<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="">P92958</a>, <a href="">Q8TDN4</a>, <a href="">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Spleen, thymus, bone marrow, ovarian carcinoma, and uterine carcinoma.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

ENSG00000110203, Expressed in blood and 127 other tissues

ExpressionAtlas, Differential and Baseline Expression

P41439, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

P41439, HS

Organism-specific databases

Human Protein Atlas

ENSG00000110203, Tissue enhanced (blood, bone marrow, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="">IntAct database</a>. It is updated at every <a href="">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

108635, 3 interactors

Protein interaction database and analysis system

P41439, 2 interactors

STRING: functional protein association networks


Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

P41439, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models


Database of comparative protein structure models


<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi


Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni124 – 128Folate bindingBy similarity5
Regioni157 – 162Folate bindingBy similarity6

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the folate receptor family.Curated

Keywords - Domaini


Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

KOG3656, Eukaryota

Ensembl GeneTree


The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms


InParanoid: Eukaryotic Ortholog Groups


KEGG Orthology (KO)


Identification of Orthologs from Complete Genome Data


Database of Orthologous Groups


Database for complete collections of gene phylogenies


Family and domain databases

Integrated resource of protein families, domains and functional sites

View protein in InterPro
IPR004269, Folate_rcpt
IPR018143, Folate_rcpt-like
IPR032934, FR-gamma

The PANTHER Classification System

PTHR10517, PTHR10517, 1 hit
PTHR10517:SF17, PTHR10517:SF17, 1 hit

Pfam protein domain database

View protein in Pfam
PF03024, Folate_rec, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="">length</a> and <a href="">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="">Sequence</a> section indicates if the <a href="">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="">Sequence</a> section indicates if the <a href="">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P41439-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
60 70 80 90 100
110 120 130 140 150
160 170 180 190 200
210 220 230 240
Mass (Da):27,885
Last modified:April 10, 2019 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i478636F757EC40DB
Isoform 2 (identifier: P41439-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-245: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. Variant in position: 150:MSAHPTWGPGSGRSTRAGAKSAF->ECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERW WEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRG.Curated
Show »
Mass (Da):17,796

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Folate receptor gamma
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Folate receptor gamma
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Folate receptor gamma
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA18381 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAA18382 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA83553 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA83566 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti45T → I in AAH30285 (PubMed:15489334).Curated1
Isoform 2 (identifier: P41439-4)
Sequence conflicti78E → V in AAH30285 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_081429107 – 245Missing 1 PublicationAdd BLAST139

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_06009057 – 172CSPWK…ECPAG → VGAPQGPSPGSVPLDDLPGA EEPEYGGDGCGGERLSPVSS PPSAVPGRRMPAARPAPARS CTRTPPACTTLTGITVVRWN PPASATLSRTAVSMSAHPTW GPGSGRSTRAGAKSAF in isoform 2. Add BLAST116
Alternative sequenceiVSP_060091173 – 245Missing in isoform 2. Add BLAST73

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database


GenBank nucleotide sequence database


DNA Data Bank of Japan; a nucleotide sequence database

Links Updated
Z32564 mRNA Translation: CAA83553.1 Different initiation.
Z32633 mRNA Translation: CAA83566.1 Different initiation.
U08471 mRNA Translation: AAA18382.1 Different initiation.
U08470 mRNA Translation: AAA18381.1 Different initiation.
AP000812 Genomic DNA No translation available.
KF459676 Genomic DNA No translation available.
BC030285 mRNA Translation: AAH30285.1

The Consensus CDS (CCDS) project

CCDS73344.1 [P41439-1]

Protein sequence database of the Protein Information Resource


NCBI Reference Sequences

NP_000795.2, NM_000804.3 [P41439-1]
NP_001304974.1, NM_001318045.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

ENST00000611028; ENSP00000481114; ENSG00000110203 [P41439-1]
ENST00000612844; ENSP00000481027; ENSG00000110203 [P41439-4]

Database of genes from NCBI RefSeq genomes


KEGG: Kyoto Encyclopedia of Genes and Genomes


UCSC genome browser

uc058ezu.1, human [P41439-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
Links Updated
Z32564 mRNA Translation: CAA83553.1 Different initiation.
Z32633 mRNA Translation: CAA83566.1 Different initiation.
U08471 mRNA Translation: AAA18382.1 Different initiation.
U08470 mRNA Translation: AAA18381.1 Different initiation.
AP000812 Genomic DNA No translation available.
KF459676 Genomic DNA No translation available.
BC030285 mRNA Translation: AAH30285.1
CCDSiCCDS73344.1 [P41439-1]
RefSeqiNP_000795.2, NM_000804.3 [P41439-1]
NP_001304974.1, NM_001318045.1

3D structure databases


Protein-protein interaction databases

BioGRIDi108635, 3 interactors
IntActiP41439, 2 interactors

Chemistry databases

DrugBankiDB00158, Folic acid
DB05168, Vintafolide

PTM databases

GlyGeniP41439, 3 sites

Polymorphism and mutation databases


Proteomic databases

ProteomicsDBi55460 [P41439-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

30810, 123 antibodies

The DNASU plasmid repository


Genome annotation databases

EnsembliENST00000611028; ENSP00000481114; ENSG00000110203 [P41439-1]
ENST00000612844; ENSP00000481027; ENSG00000110203 [P41439-4]
UCSCiuc058ezu.1, human [P41439-1]

Organism-specific databases

Comparative Toxicogenomics Database


GeneCards: human genes, protein and diseases

HPAiENSG00000110203, Tissue enhanced (blood, bone marrow, lymphoid tissue)
MIMi602469, gene

GenAtlas: human gene database


Phylogenomic databases

eggNOGiKOG3656, Eukaryota

Enzyme and pathway databases

ReactomeiR-HSA-6798695, Neutrophil degranulation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

2352, 4 hits in 140 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

FOLR3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

PharosiP41439, Tbio

Protein Ontology

RNActiP41439, protein

The Stanford Online Universal Resource for Clones and ESTs


Gene expression databases

BgeeiENSG00000110203, Expressed in blood and 127 other tissues
ExpressionAtlasiP41439, baseline and differential
GenevisibleiP41439, HS

Family and domain databases

InterProiView protein in InterPro
IPR004269, Folate_rcpt
IPR018143, Folate_rcpt-like
IPR032934, FR-gamma
PANTHERiPTHR10517, PTHR10517, 1 hit
PTHR10517:SF17, PTHR10517:SF17, 1 hit
PfamiView protein in Pfam
PF03024, Folate_rec, 1 hit

ProtoNet; Automatic hierarchical classification of proteins


MobiDB: a database of protein disorder and mobility annotations


<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFOLR3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P41439
Secondary accession number(s): A0A087WXH3, J3KQ90, Q05C14
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: April 10, 2019
Last modified: October 7, 2020
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome


  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again