Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (31 Jul 2019)
Sequence version 2 (16 Apr 2014)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Neuroblastoma suppressor of tumorigenicity 1

Gene

NBL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuroblastoma suppressor of tumorigenicity 1
Alternative name(s):
DAN domain family member 1
Protein N03
Zinc finger protein DAN
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NBL1
Synonyms:DAN, DAND1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7650 NBL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600613 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P41271

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
100532736
4681

Open Targets

More...
OpenTargetsi
ENSG00000158747

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31456

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NBL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
729293

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 161 PublicationAdd BLAST16
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000672217 – 181Neuroblastoma suppressor of tumorigenicity 1Add BLAST165

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi35 ↔ 85By similarity
Disulfide bondi49 ↔ 99By similarity
Disulfide bondi59 ↔ 118By similarity
Disulfide bondi63 ↔ 120By similarity
Disulfide bondi82 ↔ 123Sequence analysis

Keywords - PTMi

Disulfide bond

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P41271

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P41271

PeptideAtlas

More...
PeptideAtlasi
P41271

PRoteomics IDEntifications database

More...
PRIDEi
P41271

ProteomicsDB human proteome resource

More...
ProteomicsDBi
55455 [P41271-1]
55456 [P41271-2]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1549

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P41271

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Most abundant in normal lung and meningioma.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158747 Expressed in 90 organ(s), highest expression level in endocervix

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P41271 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P41271 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB026132
HPA007394

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110761, 4 interactors
1529413, 20 interactors

Protein interaction database and analysis system

More...
IntActi
P41271, 15 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000289749

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1181
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P41271

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 124CTCKAdd BLAST90

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi142 – 172Pro-richAdd BLAST31

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DAN family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IWXT Eukaryota
ENOG4111SRK LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154209

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113738

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P41271

KEGG Orthology (KO)

More...
KOi
K19558

Identification of Orthologs from Complete Genome Data

More...
OMAi
CESKSIQ

Database of Orthologous Groups

More...
OrthoDBi
1517793at2759

TreeFam database of animal gene trees

More...
TreeFami
TF106445

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.10.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006207 Cys_knot_C
IPR029034 Cystine-knot_cytokine
IPR004133 DAN
IPR016728 Neuroblast_suppress_tumour_1

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03045 DAN, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF018557 DAN_sub, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00041 CT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P41271-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMLRVLVGAV LPAMLLAAPP PINKLALFPD KSAWCEAKNI TQIVGHSGCE
60 70 80 90 100
AKSIQNRACL GQCFSYSVPN TFPQSTESLV HCDSCMPAQS MWEIVTLECP
110 120 130 140 150
GHEEVPRVDK LVEKILHCSC QACGKEPSHE GLSVYVQGED GPGSQPGTHP
160 170 180
HPHPHPHPGG QTPEPEDPPG APHTEEEGAE D
Length:181
Mass (Da):19,408
Last modified:April 16, 2014 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAE9E3264EF38DAD7
GO
Isoform 2 (identifier: P41271-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGNLMSQTSRAVSIWKFPAKLGKTHGHRALEATGM

Show »
Length:216
Mass (Da):23,169
Checksum:i61EC9DED251B33A7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RFZ1E5RFZ1_HUMAN
Neuroblastoma suppressor of tumorig...
NBL1
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTY6A0A087WTY6_HUMAN
Neuroblastoma suppressor of tumorig...
NBL1
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A3KFI5A3KFI5_HUMAN
Neuroblastoma suppressor of tumorig...
NBL1
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A3KFI4A3KFI4_HUMAN
Neuroblastoma suppressor of tumorig...
NBL1
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A3KFI3A3KFI3_HUMAN
Neuroblastoma suppressor of tumorig...
NBL1
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A3KFI2A3KFI2_HUMAN
Neuroblastoma suppressor of tumorig...
NBL1
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A3KFI1A3KFI1_HUMAN
Neuroblastoma suppressor of tumorig...
NBL1
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH12037 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA05671 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA92265 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG36074 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0364381M → MPGNLMSQTSRAVSIWKFPA KLGKTHGHRALEATGM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D28124 mRNA Translation: BAA05671.1 Different initiation.
D89013 Genomic DNA Translation: BAA92265.1 Different initiation.
AY049783 mRNA Translation: AAL15440.1
AK289456 mRNA Translation: BAF82145.1
AK292101 mRNA Translation: BAF84790.1
AK300872 mRNA Translation: BAG62517.1
AK313265 mRNA Translation: BAG36074.1 Different initiation.
AL031727 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW94894.1
CH471134 Genomic DNA Translation: EAW94895.1
BC012037 mRNA Translation: AAH12037.1 Different initiation.
BT019423 mRNA Translation: AAV38230.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS196.2 [P41271-1]
CCDS41278.1 [P41271-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001191013.1, NM_001204084.2 [P41271-1]
NP_001191014.1, NM_001204085.1 [P41271-1]
NP_001191017.1, NM_001204088.1
NP_001191018.1, NM_001204089.1 [P41271-1]
NP_001265093.1, NM_001278164.1 [P41271-1]
NP_001265094.1, NM_001278165.1 [P41271-1]
NP_001265095.1, NM_001278166.1 [P41271-1]
NP_005371.2, NM_005380.7 [P41271-1]
NP_877421.2, NM_182744.3 [P41271-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000289749; ENSP00000289749; ENSG00000158747 [P41271-2]
ENST00000375136; ENSP00000364278; ENSG00000158747 [P41271-1]
ENST00000548815; ENSP00000449007; ENSG00000158747 [P41271-1]
ENST00000602662; ENSP00000473411; ENSG00000158747 [P41271-1]
ENST00000618761; ENSP00000483061; ENSG00000158747 [P41271-1]
ENST00000621723; ENSP00000478885; ENSG00000158747 [P41271-1]
ENST00000622566; ENSP00000480391; ENSG00000158747 [P41271-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100532736
4681

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100532736
hsa:4681

UCSC genome browser

More...
UCSCi
uc001bcj.3 human [P41271-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D28124 mRNA Translation: BAA05671.1 Different initiation.
D89013 Genomic DNA Translation: BAA92265.1 Different initiation.
AY049783 mRNA Translation: AAL15440.1
AK289456 mRNA Translation: BAF82145.1
AK292101 mRNA Translation: BAF84790.1
AK300872 mRNA Translation: BAG62517.1
AK313265 mRNA Translation: BAG36074.1 Different initiation.
AL031727 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW94894.1
CH471134 Genomic DNA Translation: EAW94895.1
BC012037 mRNA Translation: AAH12037.1 Different initiation.
BT019423 mRNA Translation: AAV38230.1
CCDSiCCDS196.2 [P41271-1]
CCDS41278.1 [P41271-2]
RefSeqiNP_001191013.1, NM_001204084.2 [P41271-1]
NP_001191014.1, NM_001204085.1 [P41271-1]
NP_001191017.1, NM_001204088.1
NP_001191018.1, NM_001204089.1 [P41271-1]
NP_001265093.1, NM_001278164.1 [P41271-1]
NP_001265094.1, NM_001278165.1 [P41271-1]
NP_001265095.1, NM_001278166.1 [P41271-1]
NP_005371.2, NM_005380.7 [P41271-1]
NP_877421.2, NM_182744.3 [P41271-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4X1JX-ray2.50A/B17-132[»]
4YU8X-ray1.80A2-140[»]
SMRiP41271
ModBaseiSearch...

Protein-protein interaction databases

BioGridi110761, 4 interactors
1529413, 20 interactors
IntActiP41271, 15 interactors
STRINGi9606.ENSP00000289749

PTM databases

GlyConnecti1549
iPTMnetiP41271

Polymorphism and mutation databases

BioMutaiNBL1
DMDMi729293

Proteomic databases

jPOSTiP41271
PaxDbiP41271
PeptideAtlasiP41271
PRIDEiP41271
ProteomicsDBi55455 [P41271-1]
55456 [P41271-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4681
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000289749; ENSP00000289749; ENSG00000158747 [P41271-2]
ENST00000375136; ENSP00000364278; ENSG00000158747 [P41271-1]
ENST00000548815; ENSP00000449007; ENSG00000158747 [P41271-1]
ENST00000602662; ENSP00000473411; ENSG00000158747 [P41271-1]
ENST00000618761; ENSP00000483061; ENSG00000158747 [P41271-1]
ENST00000621723; ENSP00000478885; ENSG00000158747 [P41271-1]
ENST00000622566; ENSP00000480391; ENSG00000158747 [P41271-1]
GeneIDi100532736
4681
KEGGihsa:100532736
hsa:4681
UCSCiuc001bcj.3 human [P41271-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100532736
4681
DisGeNETi100532736
4681

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NBL1
HGNCiHGNC:7650 NBL1
HPAiCAB026132
HPA007394
MIMi600613 gene
neXtProtiNX_P41271
OpenTargetsiENSG00000158747
PharmGKBiPA31456

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IWXT Eukaryota
ENOG4111SRK LUCA
GeneTreeiENSGT00940000154209
HOGENOMiHOG000113738
InParanoidiP41271
KOiK19558
OMAiCESKSIQ
OrthoDBi1517793at2759
TreeFamiTF106445

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P41271

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158747 Expressed in 90 organ(s), highest expression level in endocervix
ExpressionAtlasiP41271 baseline and differential
GenevisibleiP41271 HS

Family and domain databases

Gene3Di2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR006207 Cys_knot_C
IPR029034 Cystine-knot_cytokine
IPR004133 DAN
IPR016728 Neuroblast_suppress_tumour_1
PfamiView protein in Pfam
PF03045 DAN, 1 hit
PIRSFiPIRSF018557 DAN_sub, 1 hit
SMARTiView protein in SMART
SM00041 CT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNBL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P41271
Secondary accession number(s): A3KFI7
, Q5TGZ2, Q5U0N4, Q96L68
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: April 16, 2014
Last modified: July 31, 2019
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again