Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 196 (16 Oct 2019)
Sequence version 2 (14 Nov 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lysine-specific demethylase 5C

Gene

KDM5C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code (PubMed:28262558). Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2 (By similarity).By similarity5 Publications

Miscellaneous

Escapes X-inactivation.

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Fe2+1 PublicationNote: Binds 1 Fe2+ ion per subunit.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

The inhibitor KDOAM-25 and others inhibit its demethylase activity, resulting to cell cycle arrest in myeloma cells.1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat are 1.92 min(-1) and 2.71 min(-1) for 2-oxoglutarate and histone H3K4me3, respectively.1 Publication
  1. KM=6 µM for 2-oxoglutarate1 Publication
  2. KM=3.3 µM for histone H3K4me31 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei4402-oxoglutarateBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi514Iron; catalytic1 Publication1
    Metal bindingi516Iron; catalytic1 Publication1
    Binding sitei5222-oxoglutarateBy similarity1
    Binding sitei5242-oxoglutarateBy similarity1
    Binding sitei5322-oxoglutarateBy similarity1
    Metal bindingi602Iron; catalytic1 Publication1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri326 – 372PHD-type 1PROSITE-ProRule annotationAdd BLAST47
    Zinc fingeri707 – 759C5HC21 PublicationAdd BLAST53
    Zinc fingeri1187 – 1248PHD-type 2PROSITE-ProRule annotationAdd BLAST62

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase, Repressor
    Biological processBiological rhythms, Transcription, Transcription regulation
    LigandIron, Metal-binding, Zinc

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    1.14.11.B2 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-3214842 HDMs demethylate histones

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Lysine-specific demethylase 5C (EC:1.14.11.-)
    Alternative name(s):
    Histone demethylase JARID1C
    Jumonji/ARID domain-containing protein 1C1 Publication
    Protein SmcX1 Publication
    Protein Xe169
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:KDM5CImported
    Synonyms:DXS1272E, JARID1C1 Publication, SMCX1 Publication, XE169
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:11114 KDM5C

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    314690 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_P41229

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Mental retardation, X-linked, syndromic, Claes-Jensen type (MRXSCJ)7 Publications
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. MRXSCJ patients manifest mental retardation associated with variable features such as slowly progressive spastic paraplegia, seizures, facial dysmorphism.
    Related information in OMIM
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03298687D → G in MRXSCJ; no effect on subcellular location and enzymatic activity. 2 Publications1
    Natural variantiVAR_022730388A → P in MRXSCJ; impairs enzymatic activity and binding to H3-K9Me3. 2 PublicationsCorresponds to variant dbSNP:rs199422235EnsemblClinVar.1
    Natural variantiVAR_022731402D → Y in MRXSCJ; decreases enzymatic activity. 3 Publications1
    Natural variantiVAR_032987451S → R in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs199422237EnsemblClinVar.1
    Natural variantiVAR_074308480P → L in MRXSCJ; patient fibroblasts show decreased enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs1057518697EnsemblClinVar.1
    Natural variantiVAR_032988642F → L in MRXSCJ; impairs enzymatic activity. 2 Publications1
    Natural variantiVAR_022732698E → K in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs1057517955EnsemblClinVar.1
    Natural variantiVAR_022733731L → F in MRXSCJ; impairs enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs199422234EnsemblClinVar.1
    Natural variantiVAR_032989750R → W in MRXSCJ. 1 Publication1
    Natural variantiVAR_032990751Y → C in MRXSCJ; impairs enzymatic activity. 3 Publications1

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi514 – 516HIE → AIA: Abolishes lysine-specific histone demethylase activity. 1 Publication3
    Mutagenesisi514H → A: Abolishes lysine-specific histone demethylase activity. 2 Publications1

    Keywords - Diseasei

    Disease mutation, Mental retardation

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    8242

    MalaCards human disease database

    More...
    MalaCardsi
    KDM5C
    MIMi300534 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000126012

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    85279 Syndromic X-linked intellectual disability due to JARID1C mutation

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA35964

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    P41229

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL2163176

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...
    GuidetoPHARMACOLOGYi
    2682

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    KDM5C

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    117949812

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002005861 – 1560Lysine-specific demethylase 5CAdd BLAST1560

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki205Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Cross-linki229Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Cross-linki244Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Cross-linki274Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei287PhosphoserineCombined sources1
    Cross-linki295Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Modified residuei301PhosphoserineCombined sources1
    Modified residuei317PhosphoserineCombined sources1
    Modified residuei893PhosphoserineBy similarity1
    Modified residuei897PhosphoserineCombined sources1
    Cross-linki1127Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Modified residuei1359PhosphoserineCombined sources1

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    P41229

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    P41229

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    P41229

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    P41229

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    P41229

    PeptideAtlas

    More...
    PeptideAtlasi
    P41229

    PRoteomics IDEntifications database

    More...
    PRIDEi
    P41229

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    2727
    55436 [P41229-1]
    55437 [P41229-2]
    55438 [P41229-3]
    55439 [P41229-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    P41229

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    P41229

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in all tissues examined. Highest levels found in brain and skeletal muscle.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000126012 Expressed in 221 organ(s), highest expression level in left ovary

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    P41229 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    P41229 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA038244
    HPA046147

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Part of two distinct complexes, one containing E2F6, and the other containing REST.

    1 Publication

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    113870, 69 interactors

    Database of interacting proteins

    More...
    DIPi
    DIP-39663N

    Protein interaction database and analysis system

    More...
    IntActi
    P41229, 46 interactors

    Molecular INTeraction database

    More...
    MINTi
    P41229

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000364550

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    P41229

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    11560
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    P41229

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    Protein Data Bank in Europe - Knowledge Base

    More...
    PDBe-KBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    P41229

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini14 – 55JmjNPROSITE-ProRule annotationAdd BLAST42
    Domaini79 – 169ARIDPROSITE-ProRule annotationAdd BLAST91
    Domaini468 – 634JmjCPROSITE-ProRule annotationAdd BLAST167

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The first PHD-type zinc finger domain recognizes and binds H3-K9Me3.
    Both the JmjC domain and the JmjN domain are required for enzymatic activity.

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the JARID1 histone demethylase family.Curated

    Zinc finger

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Zinc fingeri326 – 372PHD-type 1PROSITE-ProRule annotationAdd BLAST47
    Zinc fingeri707 – 759C5HC21 PublicationAdd BLAST53
    Zinc fingeri1187 – 1248PHD-type 2PROSITE-ProRule annotationAdd BLAST62

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1246 Eukaryota
    ENOG410XR9J LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000161236

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000290719

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    P41229

    KEGG Orthology (KO)

    More...
    KOi
    K11446

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    GDMKVES

    Database of Orthologous Groups

    More...
    OrthoDBi
    664180at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    P41229

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF106476

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    1.10.150.60, 1 hit
    3.30.40.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR001606 ARID_dom
    IPR036431 ARID_dom_sf
    IPR003347 JmjC_dom
    IPR003349 JmjN
    IPR013637 Lys_sp_deMease-like_dom
    IPR019786 Zinc_finger_PHD-type_CS
    IPR004198 Znf_C5HC2
    IPR011011 Znf_FYVE_PHD
    IPR001965 Znf_PHD
    IPR019787 Znf_PHD-finger
    IPR013083 Znf_RING/FYVE/PHD

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF01388 ARID, 1 hit
    PF02373 JmjC, 1 hit
    PF02375 JmjN, 1 hit
    PF00628 PHD, 1 hit
    PF08429 PLU-1, 1 hit
    PF02928 zf-C5HC2, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00501 BRIGHT, 1 hit
    SM00558 JmjC, 1 hit
    SM00545 JmjN, 1 hit
    SM00249 PHD, 2 hits

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF46774 SSF46774, 1 hit
    SSF57903 SSF57903, 2 hits

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS51011 ARID, 1 hit
    PS51184 JMJC, 1 hit
    PS51183 JMJN, 1 hit
    PS01359 ZF_PHD_1, 2 hits
    PS50016 ZF_PHD_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: P41229-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MEPGSDDFLP PPECPVFEPS WAEFRDPLGY IAKIRPIAEK SGICKIRPPA
    60 70 80 90 100
    DWQPPFAVEV DNFRFTPRIQ RLNELEAQTR VKLNYLDQIA KFWEIQGSSL
    110 120 130 140 150
    KIPNVERRIL DLYSLSKIVV EEGGYEAICK DRRWARVAQR LNYPPGKNIG
    160 170 180 190 200
    SLLRSHYERI VYPYEMYQSG ANLVQCNTRP FDNEEKDKEY KPHSIPLRQS
    210 220 230 240 250
    VQPSKFNSYG RRAKRLQPDP EPTEEDIEKN PELKKLQIYG AGPKMMGLGL
    260 270 280 290 300
    MAKDKTLRKK DKEGPECPPT VVVKEELGGD VKVESTSPKT FLESKEELSH
    310 320 330 340 350
    SPEPCTKMTM RLRRNHSNAQ FIESYVCRMC SRGDEDDKLL LCDGCDDNYH
    360 370 380 390 400
    IFCLLPPLPE IPKGVWRCPK CVMAECKRPP EAFGFEQATR EYTLQSFGEM
    410 420 430 440 450
    ADSFKADYFN MPVHMVPTEL VEKEFWRLVN SIEEDVTVEY GADIHSKEFG
    460 470 480 490 500
    SGFPVSDSKR HLTPEEEEYA TSGWNLNVMP VLEQSVLCHI NADISGMKVP
    510 520 530 540 550
    WLYVGMVFSA FCWHIEDHWS YSINYLHWGE PKTWYGVPSL AAEHLEEVMK
    560 570 580 590 600
    KLTPELFDSQ PDLLHQLVTL MNPNTLMSHG VPVVRTNQCA GEFVITFPRA
    610 620 630 640 650
    YHSGFNQGYN FAEAVNFCTA DWLPAGRQCI EHYRRLRRYC VFSHEELICK
    660 670 680 690 700
    MAACPEKLDL NLAAAVHKEM FIMVQEERRL RKALLEKGIT EAEREAFELL
    710 720 730 740 750
    PDDERQCIKC KTTCFLSALA CYDCPDGLVC LSHINDLCKC SSSRQYLRYR
    760 770 780 790 800
    YTLDELPAML HKLKVRAESF DTWANKVRVA LEVEDGRKRS LEELRALESE
    810 820 830 840 850
    ARERRFPNSE LLQQLKNCLS EAEACVSRAL GLVSGQEAGP HRVAGLQMTL
    860 870 880 890 900
    TELRAFLDQM NNLPCAMHQI GDVKGVLEQV EAYQAEAREA LASLPSSPGL
    910 920 930 940 950
    LQSLLERGRQ LGVEVPEAQQ LQRQVEQARW LDEVKRTLAP SARRGTLAVM
    960 970 980 990 1000
    RGLLVAGASV APSPAVDKAQ AELQELLTIA ERWEEKAHLC LEARQKHPPA
    1010 1020 1030 1040 1050
    TLEAIIREAE NIPVHLPNIQ ALKEALAKAR AWIADVDEIQ NGDHYPCLDD
    1060 1070 1080 1090 1100
    LEGLVAVGRD LPVGLEELRQ LELQVLTAHS WREKASKTFL KKNSCYTLLE
    1110 1120 1130 1140 1150
    VLCPCADAGS DSTKRSRWME KELGLYKSDT ELLGLSAQDL RDPGSVIVAF
    1160 1170 1180 1190 1200
    KEGEQKEKEG ILQLRRTNSA KPSPLASSST ASSTTSICVC GQVLAGAGAL
    1210 1220 1230 1240 1250
    QCDLCQDWFH GRCVSVPRLL SSPRPNPTSS PLLAWWEWDT KFLCPLCMRS
    1260 1270 1280 1290 1300
    RRPRLETILA LLVALQRLPV RLPEGEALQC LTERAISWQG RARQALASED
    1310 1320 1330 1340 1350
    VTALLGRLAE LRQRLQAEPR PEEPPNYPAA PASDPLREGS GKDMPKVQGL
    1360 1370 1380 1390 1400
    LENGDSVTSP EKVAPEEGSG KRDLELLSSL LPQLTGPVLE LPEATRAPLE
    1410 1420 1430 1440 1450
    ELMMEGDLLE VTLDENHSIW QLLQAGQPPD LERIRTLLEL EKAERHGSRA
    1460 1470 1480 1490 1500
    RGRALERRRR RKVDRGGEGD DPAREELEPK RVRSSGPEAE EVQEEEELEE
    1510 1520 1530 1540 1550
    ETGGEGPPAP IPTTGSPSTQ ENQNGLEPAE GTTSGPSAPF STLTPRLHLP
    1560
    CPQQPPQQQL
    Length:1,560
    Mass (Da):175,720
    Last modified:November 14, 2006 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5DC673D0091E7C87
    GO
    Isoform 2 (identifier: P41229-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1370-1372: Missing.

    Show »
    Length:1,557
    Mass (Da):175,379
    Checksum:iB1823D7AD5F78374
    GO
    Isoform 3 (identifier: P41229-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         77-117: Missing.
         1370-1372: Missing.

    Show »
    Length:1,516
    Mass (Da):170,561
    Checksum:iF82BDA8A82C57C01
    GO
    Isoform 4 (identifier: P41229-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         51-76: Missing.
         77-117: Missing.
         1370-1372: Missing.
         1420-1560: WQLLQAGQPP...CPQQPPQQQL → PESLDFCILTPRYCSDLSSWGPAPGVFPPW

    Note: No experimental confirmation available.
    Show »
    Length:1,379
    Mass (Da):155,119
    Checksum:i20A82456B8CF788E
    GO
    Isoform 5 (identifier: P41229-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         175-175: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:1,559
    Mass (Da):175,592
    Checksum:iCC245E4B78A1F039
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    F8WF56F8WF56_HUMAN
    Lysine-specific demethylase 5C
    KDM5C
    99Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8WDK1F8WDK1_HUMAN
    Lysine-specific demethylase 5C
    KDM5C
    53Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8W7H7F8W7H7_HUMAN
    Lysine-specific demethylase 5C
    KDM5C
    74Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti16V → L in BAG65494 (PubMed:14702039).Curated1
    Sequence conflicti23E → G in BAG65494 (PubMed:14702039).Curated1
    Sequence conflicti342C → Y in CAA82758 (PubMed:7951230).Curated1
    Sequence conflicti1199A → R in AAA61302 (PubMed:8162017).Curated1
    Sequence conflicti1419I → T in BAG65494 (PubMed:14702039).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_03298687D → G in MRXSCJ; no effect on subcellular location and enzymatic activity. 2 Publications1
    Natural variantiVAR_022730388A → P in MRXSCJ; impairs enzymatic activity and binding to H3-K9Me3. 2 PublicationsCorresponds to variant dbSNP:rs199422235EnsemblClinVar.1
    Natural variantiVAR_022731402D → Y in MRXSCJ; decreases enzymatic activity. 3 Publications1
    Natural variantiVAR_032987451S → R in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs199422237EnsemblClinVar.1
    Natural variantiVAR_074308480P → L in MRXSCJ; patient fibroblasts show decreased enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs1057518697EnsemblClinVar.1
    Natural variantiVAR_065091640C → Y De novo mutation found in a patient with mental retardation. 1 Publication1
    Natural variantiVAR_032988642F → L in MRXSCJ; impairs enzymatic activity. 2 Publications1
    Natural variantiVAR_022732698E → K in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs1057517955EnsemblClinVar.1
    Natural variantiVAR_022733731L → F in MRXSCJ; impairs enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs199422234EnsemblClinVar.1
    Natural variantiVAR_032989750R → W in MRXSCJ. 1 Publication1
    Natural variantiVAR_032990751Y → C in MRXSCJ; impairs enzymatic activity. 3 Publications1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04375251 – 76Missing in isoform 4. 1 PublicationAdd BLAST26
    Alternative sequenceiVSP_02641077 – 117Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST41
    Alternative sequenceiVSP_053420175Missing in isoform 5. 1 Publication1
    Alternative sequenceiVSP_0003151370 – 1372Missing in isoform 2, isoform 3 and isoform 4. 1 Publication3
    Alternative sequenceiVSP_0437531420 – 1560WQLLQ…PQQQL → PESLDFCILTPRYCSDLSSW GPAPGVFPPW in isoform 4. 1 PublicationAdd BLAST141

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    L25270 mRNA Translation: AAA61302.1
    AK304732 mRNA Translation: BAG65494.1
    AL139396 Genomic DNA No translation available.
    CH471154 Genomic DNA Translation: EAW93145.1
    BC054499 mRNA Translation: AAH54499.1
    Z29650 mRNA Translation: CAA82758.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS14351.1 [P41229-1]
    CCDS55417.1 [P41229-4]
    CCDS65269.1 [P41229-5]
    CCDS87747.1 [P41229-2]

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    I54361

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001140174.1, NM_001146702.1 [P41229-4]
    NP_001269551.1, NM_001282622.1 [P41229-5]
    NP_004178.2, NM_004187.3 [P41229-1]
    XP_005262092.1, XM_005262035.4
    XP_011529128.1, XM_011530826.2

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000375379; ENSP00000364528; ENSG00000126012 [P41229-2]
    ENST00000375383; ENSP00000364532; ENSG00000126012 [P41229-3]
    ENST00000375401; ENSP00000364550; ENSG00000126012 [P41229-1]
    ENST00000404049; ENSP00000385394; ENSG00000126012 [P41229-5]
    ENST00000452825; ENSP00000445176; ENSG00000126012 [P41229-4]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    8242

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:8242

    UCSC genome browser

    More...
    UCSCi
    uc004drz.4 human [P41229-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    L25270 mRNA Translation: AAA61302.1
    AK304732 mRNA Translation: BAG65494.1
    AL139396 Genomic DNA No translation available.
    CH471154 Genomic DNA Translation: EAW93145.1
    BC054499 mRNA Translation: AAH54499.1
    Z29650 mRNA Translation: CAA82758.1
    CCDSiCCDS14351.1 [P41229-1]
    CCDS55417.1 [P41229-4]
    CCDS65269.1 [P41229-5]
    CCDS87747.1 [P41229-2]
    PIRiI54361
    RefSeqiNP_001140174.1, NM_001146702.1 [P41229-4]
    NP_001269551.1, NM_001282622.1 [P41229-5]
    NP_004178.2, NM_004187.3 [P41229-1]
    XP_005262092.1, XM_005262035.4
    XP_011529128.1, XM_011530826.2

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2JRZNMR-A73-188[»]
    5FWJX-ray2.10A/B8-83[»]
    A/B384-772[»]
    SMRiP41229
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGridi113870, 69 interactors
    DIPiDIP-39663N
    IntActiP41229, 46 interactors
    MINTiP41229
    STRINGi9606.ENSP00000364550

    Chemistry databases

    BindingDBiP41229
    ChEMBLiCHEMBL2163176
    GuidetoPHARMACOLOGYi2682

    PTM databases

    iPTMnetiP41229
    PhosphoSitePlusiP41229

    Polymorphism and mutation databases

    BioMutaiKDM5C
    DMDMi117949812

    Proteomic databases

    EPDiP41229
    jPOSTiP41229
    MassIVEiP41229
    MaxQBiP41229
    PaxDbiP41229
    PeptideAtlasiP41229
    PRIDEiP41229
    ProteomicsDBi2727
    55436 [P41229-1]
    55437 [P41229-2]
    55438 [P41229-3]
    55439 [P41229-4]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    8242

    Genome annotation databases

    EnsembliENST00000375379; ENSP00000364528; ENSG00000126012 [P41229-2]
    ENST00000375383; ENSP00000364532; ENSG00000126012 [P41229-3]
    ENST00000375401; ENSP00000364550; ENSG00000126012 [P41229-1]
    ENST00000404049; ENSP00000385394; ENSG00000126012 [P41229-5]
    ENST00000452825; ENSP00000445176; ENSG00000126012 [P41229-4]
    GeneIDi8242
    KEGGihsa:8242
    UCSCiuc004drz.4 human [P41229-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    8242
    DisGeNETi8242

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    KDM5C
    HGNCiHGNC:11114 KDM5C
    HPAiHPA038244
    HPA046147
    MalaCardsiKDM5C
    MIMi300534 phenotype
    314690 gene
    neXtProtiNX_P41229
    OpenTargetsiENSG00000126012
    Orphaneti85279 Syndromic X-linked intellectual disability due to JARID1C mutation
    PharmGKBiPA35964

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1246 Eukaryota
    ENOG410XR9J LUCA
    GeneTreeiENSGT00940000161236
    HOGENOMiHOG000290719
    InParanoidiP41229
    KOiK11446
    OMAiGDMKVES
    OrthoDBi664180at2759
    PhylomeDBiP41229
    TreeFamiTF106476

    Enzyme and pathway databases

    BRENDAi1.14.11.B2 2681
    ReactomeiR-HSA-3214842 HDMs demethylate histones

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    KDM5C human
    EvolutionaryTraceiP41229

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    JARID1C

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    8242
    PharosiP41229

    Protein Ontology

    More...
    PROi
    PR:P41229

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000126012 Expressed in 221 organ(s), highest expression level in left ovary
    ExpressionAtlasiP41229 baseline and differential
    GenevisibleiP41229 HS

    Family and domain databases

    Gene3Di1.10.150.60, 1 hit
    3.30.40.10, 1 hit
    InterProiView protein in InterPro
    IPR001606 ARID_dom
    IPR036431 ARID_dom_sf
    IPR003347 JmjC_dom
    IPR003349 JmjN
    IPR013637 Lys_sp_deMease-like_dom
    IPR019786 Zinc_finger_PHD-type_CS
    IPR004198 Znf_C5HC2
    IPR011011 Znf_FYVE_PHD
    IPR001965 Znf_PHD
    IPR019787 Znf_PHD-finger
    IPR013083 Znf_RING/FYVE/PHD
    PfamiView protein in Pfam
    PF01388 ARID, 1 hit
    PF02373 JmjC, 1 hit
    PF02375 JmjN, 1 hit
    PF00628 PHD, 1 hit
    PF08429 PLU-1, 1 hit
    PF02928 zf-C5HC2, 1 hit
    SMARTiView protein in SMART
    SM00501 BRIGHT, 1 hit
    SM00558 JmjC, 1 hit
    SM00545 JmjN, 1 hit
    SM00249 PHD, 2 hits
    SUPFAMiSSF46774 SSF46774, 1 hit
    SSF57903 SSF57903, 2 hits
    PROSITEiView protein in PROSITE
    PS51011 ARID, 1 hit
    PS51184 JMJC, 1 hit
    PS51183 JMJN, 1 hit
    PS01359 ZF_PHD_1, 2 hits
    PS50016 ZF_PHD_2, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKDM5C_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P41229
    Secondary accession number(s): B0QZ44
    , B4E3I2, F5H3T1, Q5JUX3, Q5JUX4, Q5JUX5, Q7Z5S5
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
    Last sequence update: November 14, 2006
    Last modified: October 16, 2019
    This is version 196 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    6. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again