Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P41229 (KDM5C_HUMAN)

Entry version 207 (02 Jun 2021)
Sequence version 2 (14 Nov 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Lysine-specific demethylase 5C

Gene

KDM5C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code (PubMed:28262558).

Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2 (By similarity).

By similarity5 Publications

Miscellaneous

Escapes X-inactivation.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Fe2+1 PublicationNote: Binds 1 Fe2+ ion per subunit.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

The inhibitor KDOAM-25 and others inhibit its demethylase activity, resulting to cell cycle arrest in myeloma cells.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat are 1.92 min(-1) and 2.71 min(-1) for 2-oxoglutarate and histone H3K4me3, respectively.1 Publication
  1. KM=6 µM for 2-oxoglutarate1 Publication
  2. KM=3.3 µM for histone H3K4me31 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei4402-oxoglutarateBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi514Iron; catalytic1 Publication1
    Metal bindingi516Iron; catalytic1 Publication1
    Binding sitei5222-oxoglutarateBy similarity1
    Binding sitei5242-oxoglutarateBy similarity1
    Binding sitei5322-oxoglutarateBy similarity1
    Metal bindingi602Iron; catalytic1 Publication1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri326 – 372PHD-type 1PROSITE-ProRule annotationAdd BLAST47
    Zinc fingeri707 – 759C5HC21 PublicationAdd BLAST53
    Zinc fingeri1187 – 1248PHD-type 2PROSITE-ProRule annotationAdd BLAST62

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase, Repressor
    Biological processBiological rhythms, Transcription, Transcription regulation
    LigandIron, Metal-binding, Zinc

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...    BioCyci    		MetaCyc:ENSG00000126012-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		1.14.11.67, 2681

    Pathway Commons web resource for biological pathway data

    More...    PathwayCommonsi    		P41229

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-3214842, HDMs demethylate histones

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Lysine-specific demethylase 5C (EC:1.14.11.671 Publication)
    Alternative name(s):
    Histone demethylase JARID1C
    Jumonji/ARID domain-containing protein 1C1 Publication
    Protein SmcX1 Publication
    Protein Xe169
    [histone H3]-trimethyl-L-lysine(4) demethylase 5CCurated
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:KDM5CImported
    Synonyms:DXS1272E, JARID1C1 Publication, SMCX1 Publication, XE169
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:11114, KDM5C

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		314690, gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_P41229

    Eukaryotic Pathogen, Vector and Host Database Resources

    More...    VEuPathDBi    		HostDB:ENSG00000126012.11

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Keywords - Cellular componenti

    Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Mental retardation, X-linked, syndromic, Claes-Jensen type (MRXSCJ)7 Publications
    The disease is caused by variants affecting the gene represented in this entry.
    Disease descriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. MRXSCJ patients manifest mental retardation associated with variable features such as slowly progressive spastic paraplegia, seizures, facial dysmorphism.
    Related information in OMIM
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03298687D → G in MRXSCJ; no effect on subcellular location and enzymatic activity. 2 Publications1
    Natural variantiVAR_022730388A → P in MRXSCJ; impairs enzymatic activity and binding to H3-K9Me3. 2 PublicationsCorresponds to variant dbSNP:rs199422235EnsemblClinVar.1
    Natural variantiVAR_022731402D → Y in MRXSCJ; decreases enzymatic activity. 3 Publications1
    Natural variantiVAR_032987451S → R in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs199422237EnsemblClinVar.1
    Natural variantiVAR_074308480P → L in MRXSCJ; patient fibroblasts show decreased enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs1057518697EnsemblClinVar.1
    Natural variantiVAR_032988642F → L in MRXSCJ; impairs enzymatic activity. 2 Publications1
    Natural variantiVAR_022732698E → K in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs1057517955EnsemblClinVar.1
    Natural variantiVAR_022733731L → F in MRXSCJ; impairs enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs199422234EnsemblClinVar.1
    Natural variantiVAR_032989750R → W in MRXSCJ. 1 Publication1
    Natural variantiVAR_032990751Y → C in MRXSCJ; impairs enzymatic activity. 3 Publications1

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi514 – 516HIE → AIA: Abolishes lysine-specific histone demethylase activity. 1 Publication3
    Mutagenesisi514H → A: Abolishes lysine-specific histone demethylase activity. 2 Publications1

    Keywords - Diseasei

    Disease variant, Mental retardation

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		8242

    MalaCards human disease database

    More...    MalaCardsi    		KDM5C
    MIMi300534, phenotype

    Open Targets

    More...    OpenTargetsi    		ENSG00000126012

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...    Orphaneti    		85279, Syndromic X-linked intellectual disability due to JARID1C mutation

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA35964

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...    Pharosi    		P41229, Tchem

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...    ChEMBLi    		CHEMBL2163176

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...    GuidetoPHARMACOLOGYi    		2682

    Genetic variation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		KDM5C

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		117949812

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002005861 – 1560Lysine-specific demethylase 5CAdd BLAST1560

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki205Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Cross-linki229Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Cross-linki244Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Cross-linki274Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei287PhosphoserineCombined sources1
    Cross-linki295Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Modified residuei301PhosphoserineCombined sources1
    Modified residuei317PhosphoserineCombined sources1
    Modified residuei893PhosphoserineBy similarity1
    Modified residuei897PhosphoserineCombined sources1
    Cross-linki1127Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
    Modified residuei1359PhosphoserineCombined sources1

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		P41229

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		P41229

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...    MassIVEi    		P41229

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		P41229

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		P41229

    PeptideAtlas

    More...    PeptideAtlasi    		P41229

    PRoteomics IDEntifications database

    More...    PRIDEi    		P41229

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		2727
    55436 [P41229-1]
    55437 [P41229-2]
    55438 [P41229-3]
    55439 [P41229-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		P41229

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		P41229

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in all tissues examined. Highest levels found in brain and skeletal muscle.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000126012, Expressed in sural nerve and 232 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		P41229, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		P41229, HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		ENSG00000126012, Low tissue specificity

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Part of two distinct complexes, one containing E2F6, and the other containing REST.

    1 Publication

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Hide details

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		113870, 76 interactors

    Database of interacting proteins

    More...    DIPi    		DIP-39663N

    Protein interaction database and analysis system

    More...    IntActi    		P41229, 50 interactors

    Molecular INTeraction database

    More...    MINTi    		P41229

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000364550

    Chemistry databases

    BindingDB database of measured binding affinities

    More...    BindingDBi    		P41229

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		P41229, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    11560
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Biological Magnetic Resonance Data Bank

    More...    BMRBi    		P41229

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		P41229

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    Protein Data Bank in Europe - Knowledge Base

    More...    PDBe-KBi    		Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...    EvolutionaryTracei    		P41229

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini14 – 55JmjNPROSITE-ProRule annotationAdd BLAST42
    Domaini79 – 169ARIDPROSITE-ProRule annotationAdd BLAST91
    Domaini468 – 634JmjCPROSITE-ProRule annotationAdd BLAST167

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni197 – 227DisorderedSequence analysisAdd BLAST31
    Regioni1161 – 1181DisorderedSequence analysisAdd BLAST21
    Regioni1316 – 1371DisorderedSequence analysisAdd BLAST56
    Regioni1444 – 1560DisorderedSequence analysisAdd BLAST117

    Compositional bias

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi212 – 227Basic and acidic residuesSequence analysisAdd BLAST16
    Compositional biasi1166 – 1181Polar residuesSequence analysisAdd BLAST16
    Compositional biasi1461 – 1489Basic and acidic residuesSequence analysisAdd BLAST29
    Compositional biasi1515 – 1541Polar residuesSequence analysisAdd BLAST27

    <p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The first PHD-type zinc finger domain recognizes and binds H3-K9Me3.
    Both the JmjC domain and the JmjN domain are required for enzymatic activity.

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the JARID1 histone demethylase family.Curated

    Zinc finger

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Zinc fingeri326 – 372PHD-type 1PROSITE-ProRule annotationAdd BLAST47
    Zinc fingeri707 – 759C5HC21 PublicationAdd BLAST53
    Zinc fingeri1187 – 1248PHD-type 2PROSITE-ProRule annotationAdd BLAST62

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG1246, Eukaryota

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000161236

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_000991_2_2_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		P41229

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		FHGGCVS

    Database of Orthologous Groups

    More...    OrthoDBi    		664180at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		P41229

    TreeFam database of animal gene trees

    More...    TreeFami    		TF106476

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		1.10.150.60, 1 hit
    3.30.40.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR001606, ARID_dom
    IPR036431, ARID_dom_sf
    IPR003347, JmjC_dom
    IPR003349, JmjN
    IPR013637, Lys_sp_deMease-like_dom
    IPR019786, Zinc_finger_PHD-type_CS
    IPR004198, Znf_C5HC2
    IPR011011, Znf_FYVE_PHD
    IPR001965, Znf_PHD
    IPR019787, Znf_PHD-finger
    IPR013083, Znf_RING/FYVE/PHD

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF01388, ARID, 1 hit
    PF02373, JmjC, 1 hit
    PF02375, JmjN, 1 hit
    PF00628, PHD, 1 hit
    PF08429, PLU-1, 1 hit
    PF02928, zf-C5HC2, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...    SMARTi    		View protein in SMART
    SM00501, BRIGHT, 1 hit
    SM00558, JmjC, 1 hit
    SM00545, JmjN, 1 hit
    SM00249, PHD, 2 hits

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF46774, SSF46774, 1 hit
    SSF57903, SSF57903, 2 hits

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS51011, ARID, 1 hit
    PS51184, JMJC, 1 hit
    PS51183, JMJN, 1 hit
    PS01359, ZF_PHD_1, 2 hits
    PS50016, ZF_PHD_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: P41229-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MEPGSDDFLP PPECPVFEPS WAEFRDPLGY IAKIRPIAEK SGICKIRPPA 
            60         70         80         90        100
    DWQPPFAVEV DNFRFTPRIQ RLNELEAQTR VKLNYLDQIA KFWEIQGSSL 
           110        120        130        140        150
    KIPNVERRIL DLYSLSKIVV EEGGYEAICK DRRWARVAQR LNYPPGKNIG 
           160        170        180        190        200
    SLLRSHYERI VYPYEMYQSG ANLVQCNTRP FDNEEKDKEY KPHSIPLRQS 
           210        220        230        240        250
    VQPSKFNSYG RRAKRLQPDP EPTEEDIEKN PELKKLQIYG AGPKMMGLGL 
           260        270        280        290        300
    MAKDKTLRKK DKEGPECPPT VVVKEELGGD VKVESTSPKT FLESKEELSH 
           310        320        330        340        350
    SPEPCTKMTM RLRRNHSNAQ FIESYVCRMC SRGDEDDKLL LCDGCDDNYH 
           360        370        380        390        400
    IFCLLPPLPE IPKGVWRCPK CVMAECKRPP EAFGFEQATR EYTLQSFGEM 
           410        420        430        440        450
    ADSFKADYFN MPVHMVPTEL VEKEFWRLVN SIEEDVTVEY GADIHSKEFG 
           460        470        480        490        500
    SGFPVSDSKR HLTPEEEEYA TSGWNLNVMP VLEQSVLCHI NADISGMKVP 
           510        520        530        540        550
    WLYVGMVFSA FCWHIEDHWS YSINYLHWGE PKTWYGVPSL AAEHLEEVMK 
           560        570        580        590        600
    KLTPELFDSQ PDLLHQLVTL MNPNTLMSHG VPVVRTNQCA GEFVITFPRA 
           610        620        630        640        650
    YHSGFNQGYN FAEAVNFCTA DWLPAGRQCI EHYRRLRRYC VFSHEELICK 
           660        670        680        690        700
    MAACPEKLDL NLAAAVHKEM FIMVQEERRL RKALLEKGIT EAEREAFELL 
           710        720        730        740        750
    PDDERQCIKC KTTCFLSALA CYDCPDGLVC LSHINDLCKC SSSRQYLRYR 
           760        770        780        790        800
    YTLDELPAML HKLKVRAESF DTWANKVRVA LEVEDGRKRS LEELRALESE 
           810        820        830        840        850
    ARERRFPNSE LLQQLKNCLS EAEACVSRAL GLVSGQEAGP HRVAGLQMTL 
           860        870        880        890        900
    TELRAFLDQM NNLPCAMHQI GDVKGVLEQV EAYQAEAREA LASLPSSPGL 
           910        920        930        940        950
    LQSLLERGRQ LGVEVPEAQQ LQRQVEQARW LDEVKRTLAP SARRGTLAVM 
           960        970        980        990       1000
    RGLLVAGASV APSPAVDKAQ AELQELLTIA ERWEEKAHLC LEARQKHPPA 
          1010       1020       1030       1040       1050
    TLEAIIREAE NIPVHLPNIQ ALKEALAKAR AWIADVDEIQ NGDHYPCLDD 
          1060       1070       1080       1090       1100
    LEGLVAVGRD LPVGLEELRQ LELQVLTAHS WREKASKTFL KKNSCYTLLE 
          1110       1120       1130       1140       1150
    VLCPCADAGS DSTKRSRWME KELGLYKSDT ELLGLSAQDL RDPGSVIVAF 
          1160       1170       1180       1190       1200
    KEGEQKEKEG ILQLRRTNSA KPSPLASSST ASSTTSICVC GQVLAGAGAL 
          1210       1220       1230       1240       1250
    QCDLCQDWFH GRCVSVPRLL SSPRPNPTSS PLLAWWEWDT KFLCPLCMRS 
          1260       1270       1280       1290       1300
    RRPRLETILA LLVALQRLPV RLPEGEALQC LTERAISWQG RARQALASED 
          1310       1320       1330       1340       1350
    VTALLGRLAE LRQRLQAEPR PEEPPNYPAA PASDPLREGS GKDMPKVQGL 
          1360       1370       1380       1390       1400
    LENGDSVTSP EKVAPEEGSG KRDLELLSSL LPQLTGPVLE LPEATRAPLE 
          1410       1420       1430       1440       1450
    ELMMEGDLLE VTLDENHSIW QLLQAGQPPD LERIRTLLEL EKAERHGSRA 
          1460       1470       1480       1490       1500
    RGRALERRRR RKVDRGGEGD DPAREELEPK RVRSSGPEAE EVQEEEELEE 
          1510       1520       1530       1540       1550
    ETGGEGPPAP IPTTGSPSTQ ENQNGLEPAE GTTSGPSAPF STLTPRLHLP 
          1560
    CPQQPPQQQL
    Length:1,560
    Mass (Da):175,720
    Last modified:November 14, 2006 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5DC673D0091E7C87
    GO
    Isoform 2 (identifier: P41229-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1370-1372: Missing.

    Show »
    Length:1,557
    Mass (Da):175,379
    Checksum:iB1823D7AD5F78374
    GO
    Isoform 3 (identifier: P41229-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         77-117: Missing.
         1370-1372: Missing.

    Show »
    Length:1,516
    Mass (Da):170,561
    Checksum:iF82BDA8A82C57C01
    GO
    Isoform 4 (identifier: P41229-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         51-76: Missing.
         77-117: Missing.
         1370-1372: Missing.
         1420-1560: WQLLQAGQPP...CPQQPPQQQL → PESLDFCILTPRYCSDLSSWGPAPGVFPPW

    Show »
    Length:1,379
    Mass (Da):155,119
    Checksum:i20A82456B8CF788E
    GO
    Isoform 5 (identifier: P41229-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         175-175: Missing.

    Show »
    Length:1,559
    Mass (Da):175,592
    Checksum:iCC245E4B78A1F039
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    F8WF56F8WF56_HUMAN
    Lysine-specific demethylase 5C
    KDM5C
    		99Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8W7H7F8W7H7_HUMAN
    Lysine-specific demethylase 5C
    KDM5C
    		74Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8WDK1F8WDK1_HUMAN
    Lysine-specific demethylase 5C
    KDM5C
    		53Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti16V → L in BAG65494 (PubMed:14702039).Curated1
    Sequence conflicti23E → G in BAG65494 (PubMed:14702039).Curated1
    Sequence conflicti342C → Y in CAA82758 (PubMed:7951230).Curated1
    Sequence conflicti1199A → R in AAA61302 (PubMed:8162017).Curated1
    Sequence conflicti1419I → T in BAG65494 (PubMed:14702039).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_03298687D → G in MRXSCJ; no effect on subcellular location and enzymatic activity. 2 Publications1
    Natural variantiVAR_022730388A → P in MRXSCJ; impairs enzymatic activity and binding to H3-K9Me3. 2 PublicationsCorresponds to variant dbSNP:rs199422235EnsemblClinVar.1
    Natural variantiVAR_022731402D → Y in MRXSCJ; decreases enzymatic activity. 3 Publications1
    Natural variantiVAR_032987451S → R in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs199422237EnsemblClinVar.1
    Natural variantiVAR_074308480P → L in MRXSCJ; patient fibroblasts show decreased enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs1057518697EnsemblClinVar.1
    Natural variantiVAR_065091640C → Y De novo mutation found in a patient with mental retardation. 1 Publication1
    Natural variantiVAR_032988642F → L in MRXSCJ; impairs enzymatic activity. 2 Publications1
    Natural variantiVAR_022732698E → K in MRXSCJ. 1 PublicationCorresponds to variant dbSNP:rs1057517955EnsemblClinVar.1
    Natural variantiVAR_022733731L → F in MRXSCJ; impairs enzymatic activity. 2 PublicationsCorresponds to variant dbSNP:rs199422234EnsemblClinVar.1
    Natural variantiVAR_032989750R → W in MRXSCJ. 1 Publication1
    Natural variantiVAR_032990751Y → C in MRXSCJ; impairs enzymatic activity. 3 Publications1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04375251 – 76Missing in isoform 4. 1 PublicationAdd BLAST26
    Alternative sequenceiVSP_02641077 – 117Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST41
    Alternative sequenceiVSP_053420175Missing in isoform 5. 1 Publication1
    Alternative sequenceiVSP_0003151370 – 1372Missing in isoform 2, isoform 3 and isoform 4. 1 Publication3
    Alternative sequenceiVSP_0437531420 – 1560WQLLQ…PQQQL → PESLDFCILTPRYCSDLSSW GPAPGVFPPW in isoform 4. 1 PublicationAdd BLAST141

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		L25270 mRNA Translation: AAA61302.1
    AK304732 mRNA Translation: BAG65494.1
    AL139396 Genomic DNA No translation available.
    CH471154 Genomic DNA Translation: EAW93145.1
    BC054499 mRNA Translation: AAH54499.1
    Z29650 mRNA Translation: CAA82758.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS14351.1 [P41229-1]
    CCDS55417.1 [P41229-4]
    CCDS65269.1 [P41229-5]
    CCDS87747.1 [P41229-2]

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		I54361

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001140174.1, NM_001146702.1 [P41229-4]
    NP_001269551.1, NM_001282622.1 [P41229-5]
    NP_004178.2, NM_004187.3 [P41229-1]
    XP_005262092.1, XM_005262035.4
    XP_011529128.1, XM_011530826.2

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000375379; ENSP00000364528; ENSG00000126012 [P41229-2]
    ENST00000375383; ENSP00000364532; ENSG00000126012 [P41229-3]
    ENST00000375401; ENSP00000364550; ENSG00000126012 [P41229-1]
    ENST00000404049; ENSP00000385394; ENSG00000126012 [P41229-5]
    ENST00000452825; ENSP00000445176; ENSG00000126012 [P41229-4]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		8242

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:8242

    UCSC genome browser

    More...    UCSCi    		uc004drz.4, human [P41229-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		L25270 mRNA Translation: AAA61302.1
    AK304732 mRNA Translation: BAG65494.1
    AL139396 Genomic DNA No translation available.
    CH471154 Genomic DNA Translation: EAW93145.1
    BC054499 mRNA Translation: AAH54499.1
    Z29650 mRNA Translation: CAA82758.1
    CCDSiCCDS14351.1 [P41229-1]
    CCDS55417.1 [P41229-4]
    CCDS65269.1 [P41229-5]
    CCDS87747.1 [P41229-2]
    PIRiI54361
    RefSeqiNP_001140174.1, NM_001146702.1 [P41229-4]
    NP_001269551.1, NM_001282622.1 [P41229-5]
    NP_004178.2, NM_004187.3 [P41229-1]
    XP_005262092.1, XM_005262035.4
    XP_011529128.1, XM_011530826.2

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...    PDBei

    Protein Data Bank RCSB

    More...    RCSB PDBi

    Protein Data Bank Japan

    More...    PDBji
    Links Updated
    		PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2JRZNMR-A73-188[»]
    5FWJX-ray2.10A/B8-83[»]
    A/B384-772[»]
    BMRBiP41229
    SMRiP41229
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi113870, 76 interactors
    DIPiDIP-39663N
    IntActiP41229, 50 interactors
    MINTiP41229
    STRINGi9606.ENSP00000364550

    Chemistry databases

    BindingDBiP41229
    ChEMBLiCHEMBL2163176
    GuidetoPHARMACOLOGYi2682

    PTM databases

    iPTMnetiP41229
    PhosphoSitePlusiP41229

    Genetic variation databases

    BioMutaiKDM5C
    DMDMi117949812

    Proteomic databases

    EPDiP41229
    jPOSTiP41229
    MassIVEiP41229
    MaxQBiP41229
    PaxDbiP41229
    PeptideAtlasiP41229
    PRIDEiP41229
    ProteomicsDBi2727
    55436 [P41229-1]
    55437 [P41229-2]
    55438 [P41229-3]
    55439 [P41229-4]

    Protocols and materials databases

    ABCD curated depository of sequenced antibodies

    More...    ABCDi    		P41229, 1 sequenced antibody

    Antibodypedia a portal for validated antibodies

    More...    Antibodypediai    		26540, 199 antibodies

    The DNASU plasmid repository

    More...    DNASUi    		8242

    Genome annotation databases

    EnsembliENST00000375379; ENSP00000364528; ENSG00000126012 [P41229-2]
    ENST00000375383; ENSP00000364532; ENSG00000126012 [P41229-3]
    ENST00000375401; ENSP00000364550; ENSG00000126012 [P41229-1]
    ENST00000404049; ENSP00000385394; ENSG00000126012 [P41229-5]
    ENST00000452825; ENSP00000445176; ENSG00000126012 [P41229-4]
    GeneIDi8242
    KEGGihsa:8242
    UCSCiuc004drz.4, human [P41229-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		8242
    DisGeNETi8242

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		KDM5C
    HGNCiHGNC:11114, KDM5C
    HPAiENSG00000126012, Low tissue specificity
    MalaCardsiKDM5C
    MIMi300534, phenotype
    314690, gene
    neXtProtiNX_P41229
    OpenTargetsiENSG00000126012
    Orphaneti85279, Syndromic X-linked intellectual disability due to JARID1C mutation
    PharmGKBiPA35964
    VEuPathDBiHostDB:ENSG00000126012.11

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG1246, Eukaryota
    GeneTreeiENSGT00940000161236
    HOGENOMiCLU_000991_2_2_1
    InParanoidiP41229
    OMAiFHGGCVS
    OrthoDBi664180at2759
    PhylomeDBiP41229
    TreeFamiTF106476

    Enzyme and pathway databases

    BioCyciMetaCyc:ENSG00000126012-MONOMER
    BRENDAi1.14.11.67, 2681
    PathwayCommonsiP41229
    ReactomeiR-HSA-3214842, HDMs demethylate histones

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...    BioGRID-ORCSi    		8242, 55 hits in 650 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		KDM5C, human
    EvolutionaryTraceiP41229

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		JARID1C

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		8242
    PharosiP41229, Tchem

    Protein Ontology

    More...    PROi    		PR:P41229
    RNActiP41229, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000126012, Expressed in sural nerve and 232 other tissues
    ExpressionAtlasiP41229, baseline and differential
    GenevisibleiP41229, HS

    Family and domain databases

    Gene3Di1.10.150.60, 1 hit
    3.30.40.10, 1 hit
    InterProiView protein in InterPro
    IPR001606, ARID_dom
    IPR036431, ARID_dom_sf
    IPR003347, JmjC_dom
    IPR003349, JmjN
    IPR013637, Lys_sp_deMease-like_dom
    IPR019786, Zinc_finger_PHD-type_CS
    IPR004198, Znf_C5HC2
    IPR011011, Znf_FYVE_PHD
    IPR001965, Znf_PHD
    IPR019787, Znf_PHD-finger
    IPR013083, Znf_RING/FYVE/PHD
    PfamiView protein in Pfam
    PF01388, ARID, 1 hit
    PF02373, JmjC, 1 hit
    PF02375, JmjN, 1 hit
    PF00628, PHD, 1 hit
    PF08429, PLU-1, 1 hit
    PF02928, zf-C5HC2, 1 hit
    SMARTiView protein in SMART
    SM00501, BRIGHT, 1 hit
    SM00558, JmjC, 1 hit
    SM00545, JmjN, 1 hit
    SM00249, PHD, 2 hits
    SUPFAMiSSF46774, SSF46774, 1 hit
    SSF57903, SSF57903, 2 hits
    PROSITEiView protein in PROSITE
    PS51011, ARID, 1 hit
    PS51184, JMJC, 1 hit
    PS51183, JMJN, 1 hit
    PS01359, ZF_PHD_1, 2 hits
    PS50016, ZF_PHD_2, 1 hit

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKDM5C_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P41229
    Secondary accession number(s): B0QZ44
    , B4E3I2, F5H3T1, Q5JUX3, Q5JUX4, Q5JUX5, Q7Z5S5
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
    Last sequence update: November 14, 2006
    Last modified: June 2, 2021
    This is version 207 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with genetic variants
      List of human entries with genetic variants
    3. Human variants curated from literature reports
      Index of human variants curated from literature reports
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again