Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ETS translocation variant 5

Gene

ETV5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds to DNA sequences containing the consensus nucleotide core sequence 5'-GGAA.-3'.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi368 – 448ETSPROSITE-ProRule annotationAdd BLAST81

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding

Enzyme and pathway databases

SIGNORiP41161

Names & Taxonomyi

Protein namesi
Recommended name:
ETS translocation variant 5
Alternative name(s):
Ets-related protein ERM
Gene namesi
Name:ETV5
Synonyms:ERM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000244405.7
HGNCiHGNC:3494 ETV5
MIMi601600 gene
neXtProtiNX_P41161

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi2119
OpenTargetsiENSG00000244405
PharmGKBiPA27908

Polymorphism and mutation databases

BioMutaiETV5
DMDMi729441

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002041181 – 510ETS translocation variant 5Add BLAST510

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei248PhosphoserineCombined sources1
Cross-linki350Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP41161
PeptideAtlasiP41161
PRIDEiP41161
ProteomicsDBi55407

PTM databases

iPTMnetiP41161
PhosphoSitePlusiP41161

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000244405 Expressed in 208 organ(s), highest expression level in lung
CleanExiHS_ETV5
ExpressionAtlasiP41161 baseline and differential
GenevisibleiP41161 HS

Organism-specific databases

HPAiCAB009590
HPA063065

Interactioni

Subunit structurei

Interacts (via C-terminal) with ZMYM5 (via N-terminal 120 amino acid region).1 Publication

Protein-protein interaction databases

BioGridi108420, 21 interactors
IntActiP41161, 13 interactors
STRINGi9606.ENSP00000306894

Structurei

Secondary structure

1510
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP41161
SMRiP41161
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ETS family.Curated

Phylogenomic databases

eggNOGiKOG3806 Eukaryota
ENOG410Z0ZF LUCA
GeneTreeiENSGT00760000118907
HOGENOMiHOG000230986
HOVERGENiHBG000231
InParanoidiP41161
KOiK15593
OMAiSPTHQNP
OrthoDBiEOG091G04YU
PhylomeDBiP41161
TreeFamiTF316214

Family and domain databases

Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000418 Ets_dom
IPR006715 ETS_PEA3_N
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00178 Ets, 1 hit
PF04621 ETS_PEA3_N, 1 hit
PRINTSiPR00454 ETSDOMAIN
SMARTiView protein in SMART
SM00413 ETS, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS00345 ETS_DOMAIN_1, 1 hit
PS00346 ETS_DOMAIN_2, 1 hit
PS50061 ETS_DOMAIN_3, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P41161-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGFYDQQVP FMVPGKSRSE ECRGRPVIDR KRKFLDTDLA HDSEELFQDL
60 70 80 90 100
SQLQEAWLAE AQVPDDEQFV PDFQSDNLVL HAPPPTKIKR ELHSPSSELS
110 120 130 140 150
SCSHEQALGA NYGEKCLYNY CAYDRKPPSG FKPLTPPTTP LSPTHQNPLF
160 170 180 190 200
PPPQATLPTS GHAPAAGPVQ GVGPAPAPHS LPEPGPQQQT FAVPRPPHQP
210 220 230 240 250
LQMPKMMPEN QYPSEQRFQR QLSEPCHPFP PQPGVPGDNR PSYHRQMSEP
260 270 280 290 300
IVPAAPPPPQ GFKQEYHDPL YEHGVPGMPG PPAHGFQSPM GIKQEPRDYC
310 320 330 340 350
VDSEVPNCQS SYMRGGYFSS SHEGFSYEKD PRLYFDDTCV VPERLEGKVK
360 370 380 390 400
QEPTMYREGP PYQRRGSLQL WQFLVTLLDD PANAHFIAWT GRGMEFKLIE
410 420 430 440 450
PEEVARRWGI QKNRPAMNYD KLSRSLRYYY EKGIMQKVAG ERYVYKFVCD
460 470 480 490 500
PDALFSMAFP DNQRPFLKAE SECHLSEEDT LPLTHFEDSP AYLLDMDRCS
510
SLPYAEGFAY
Length:510
Mass (Da):57,838
Last modified:February 1, 1995 - v1
Checksum:iB7CE40A33927F46E
GO
Isoform 2 (identifier: P41161-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSERRCPPEHREGVNDTGGSLFPQKLLNAETSQSGIRDAESTM

Note: No experimental confirmation available.
Show »
Length:552
Mass (Da):62,422
Checksum:iAE21DD036DB1BC24
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J0Z2C9J0Z2_HUMAN
ETS translocation variant 5
ETV5
140Annotation score:
C9JMF0C9JMF0_HUMAN
ETS translocation variant 5
ETV5
150Annotation score:
C9J5A5C9J5A5_HUMAN
ETS translocation variant 5
ETV5
132Annotation score:
H7C1D2H7C1D2_HUMAN
ETS translocation variant 5
ETV5
89Annotation score:
C9JR66C9JR66_HUMAN
ETS translocation variant 5
ETV5
132Annotation score:

Mass spectrometryi

Molecular mass is 57837.98 Da from positions 1 - 510. Determined by MALDI. 1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048951348K → R. Corresponds to variant dbSNP:rs2228269Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0554891M → MSERRCPPEHREGVNDTGGS LFPQKLLNAETSQSGIRDAE STM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76184 mRNA Translation: CAA53778.1
X96381
, X96380, X96382, X96379, X96378, X96377, X96376, X96375 Genomic DNA Translation: CAA65246.1
AK301878 mRNA Translation: BAH13573.1
CR456767 mRNA Translation: CAG33048.1
BT006713 mRNA Translation: AAP35359.1
AC108671 Genomic DNA No translation available.
AC112649 Genomic DNA No translation available.
AC131156 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78200.1
BC007333 mRNA Translation: AAH07333.1
CCDSiCCDS33906.1 [P41161-1]
PIRiS43692
RefSeqiNP_004445.1, NM_004454.2 [P41161-1]
UniGeneiHs.43697

Genome annotation databases

EnsembliENST00000306376; ENSP00000306894; ENSG00000244405 [P41161-1]
ENST00000434744; ENSP00000413755; ENSG00000244405 [P41161-1]
GeneIDi2119
KEGGihsa:2119
UCSCiuc003fpz.4 human [P41161-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76184 mRNA Translation: CAA53778.1
X96381
, X96380, X96382, X96379, X96378, X96377, X96376, X96375 Genomic DNA Translation: CAA65246.1
AK301878 mRNA Translation: BAH13573.1
CR456767 mRNA Translation: CAG33048.1
BT006713 mRNA Translation: AAP35359.1
AC108671 Genomic DNA No translation available.
AC112649 Genomic DNA No translation available.
AC131156 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78200.1
BC007333 mRNA Translation: AAH07333.1
CCDSiCCDS33906.1 [P41161-1]
PIRiS43692
RefSeqiNP_004445.1, NM_004454.2 [P41161-1]
UniGeneiHs.43697

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4UNOX-ray1.95A365-462[»]
5ILVX-ray1.80A366-457[»]
ProteinModelPortaliP41161
SMRiP41161
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108420, 21 interactors
IntActiP41161, 13 interactors
STRINGi9606.ENSP00000306894

PTM databases

iPTMnetiP41161
PhosphoSitePlusiP41161

Polymorphism and mutation databases

BioMutaiETV5
DMDMi729441

Proteomic databases

PaxDbiP41161
PeptideAtlasiP41161
PRIDEiP41161
ProteomicsDBi55407

Protocols and materials databases

DNASUi2119
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306376; ENSP00000306894; ENSG00000244405 [P41161-1]
ENST00000434744; ENSP00000413755; ENSG00000244405 [P41161-1]
GeneIDi2119
KEGGihsa:2119
UCSCiuc003fpz.4 human [P41161-1]

Organism-specific databases

CTDi2119
DisGeNETi2119
EuPathDBiHostDB:ENSG00000244405.7
GeneCardsiETV5
HGNCiHGNC:3494 ETV5
HPAiCAB009590
HPA063065
MIMi601600 gene
neXtProtiNX_P41161
OpenTargetsiENSG00000244405
PharmGKBiPA27908
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3806 Eukaryota
ENOG410Z0ZF LUCA
GeneTreeiENSGT00760000118907
HOGENOMiHOG000230986
HOVERGENiHBG000231
InParanoidiP41161
KOiK15593
OMAiSPTHQNP
OrthoDBiEOG091G04YU
PhylomeDBiP41161
TreeFamiTF316214

Enzyme and pathway databases

SIGNORiP41161

Miscellaneous databases

ChiTaRSiETV5 human
GenomeRNAii2119
PROiPR:P41161
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000244405 Expressed in 208 organ(s), highest expression level in lung
CleanExiHS_ETV5
ExpressionAtlasiP41161 baseline and differential
GenevisibleiP41161 HS

Family and domain databases

Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000418 Ets_dom
IPR006715 ETS_PEA3_N
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00178 Ets, 1 hit
PF04621 ETS_PEA3_N, 1 hit
PRINTSiPR00454 ETSDOMAIN
SMARTiView protein in SMART
SM00413 ETS, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS00345 ETS_DOMAIN_1, 1 hit
PS00346 ETS_DOMAIN_2, 1 hit
PS50061 ETS_DOMAIN_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiETV5_HUMAN
AccessioniPrimary (citable) accession number: P41161
Secondary accession number(s): A6NH46, B7Z7D7, Q6IBN5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: November 7, 2018
This is version 164 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again