Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Replication factor C subunit 3

Gene

RFC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.

GO - Molecular functioni

  • DNA clamp loader activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processDNA replication

Enzyme and pathway databases

ReactomeiR-HSA-110312 Translesion synthesis by REV1
R-HSA-110314 Recognition of DNA damage by PCNA-containing replication complex
R-HSA-110320 Translesion Synthesis by POLH
R-HSA-174411 Polymerase switching on the C-strand of the telomere
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-5651801 PCNA-Dependent Long Patch Base Excision Repair
R-HSA-5655862 Translesion synthesis by POLK
R-HSA-5656121 Translesion synthesis by POLI
R-HSA-5656169 Termination of translesion DNA synthesis
R-HSA-5685938 HDR through Single Strand Annealing (SSA)
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-5696397 Gap-filling DNA repair synthesis and ligation in GG-NER
R-HSA-5696400 Dual Incision in GG-NER
R-HSA-6782135 Dual incision in TC-NER
R-HSA-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-69091 Polymerase switching
R-HSA-69473 G2/M DNA damage checkpoint

Names & Taxonomyi

Protein namesi
Recommended name:
Replication factor C subunit 3
Alternative name(s):
Activator 1 38 kDa subunit
Short name:
A1 38 kDa subunit
Activator 1 subunit 3
Replication factor C 38 kDa subunit
Short name:
RF-C 38 kDa subunit
Short name:
RFC38
Gene namesi
Name:RFC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000133119.12
HGNCiHGNC:9971 RFC3
MIMi600405 gene
neXtProtiNX_P40938

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5983
OpenTargetsiENSG00000133119
PharmGKBiPA34340

Polymorphism and mutation databases

BioMutaiRFC3
DMDMi3915601

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001217611 – 356Replication factor C subunit 3Add BLAST356

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei20N6-acetyllysineCombined sources1
Modified residuei125PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP40938
MaxQBiP40938
PaxDbiP40938
PeptideAtlasiP40938
PRIDEiP40938
ProteomicsDBi55391

PTM databases

iPTMnetiP40938
PhosphoSitePlusiP40938
SwissPalmiP40938

Expressioni

Gene expression databases

BgeeiENSG00000133119
CleanExiHS_RFC3
ExpressionAtlasiP40938 baseline and differential
GenevisibleiP40938 HS

Organism-specific databases

HPAiHPA030149

Interactioni

Subunit structurei

Heterotetramer of subunits RFC2, RFC3, RFC4 and RFC5 that can form a complex either with RFC1 or with RAD17. The former interacts with PCNA in the presence of ATP, while the latter has ATPase activity but is not stimulated by PCNA.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
RFC4P352497EBI-1055010,EBI-476655

Protein-protein interaction databases

BioGridi111915, 56 interactors
ComplexPortaliCPX-415 DNA replication factor C complex
CORUMiP40938
DIPiDIP-36432N
IntActiP40938, 41 interactors
MINTiP40938
STRINGi9606.ENSP00000369411

Structurei

3D structure databases

ProteinModelPortaliP40938
SMRiP40938
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the activator 1 small subunits family.Curated

Phylogenomic databases

eggNOGiKOG2035 Eukaryota
COG0470 LUCA
GeneTreeiENSGT00550000075006
HOGENOMiHOG000224153
HOVERGENiHBG040509
InParanoidiP40938
KOiK10756
OMAiLSHCIPP
OrthoDBiEOG091G0BQF
PhylomeDBiP40938
TreeFamiTF105724

Family and domain databases

InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR008921 DNA_pol3_clamp-load_cplx_C
IPR027417 P-loop_NTPase
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF48019 SSF48019, 1 hit
SSF52540 SSF52540, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P40938-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLWVDKYRP CSLGRLDYHK EQAAQLRNLV QCGDFPHLLV YGPSGAGKKT
60 70 80 90 100
RIMCILRELY GVGVEKLRIE HQTITTPSKK KIEISTIASN YHLEVNPSDA
110 120 130 140 150
GNSDRVVIQE MLKTVAQSQQ LETNSQRDFK VVLLTEVDKL TKDAQHALRR
160 170 180 190 200
TMEKYMSTCR LILCCNSTSK VIPPIRSRCL AVRVPAPSIE DICHVLSTVC
210 220 230 240 250
KKEGLNLPSQ LAHRLAEKSC RNLRKALLMC EACRVQQYPF TADQEIPETD
260 270 280 290 300
WEVYLRETAN AIVSQQTPQR LLEVRGRLYE LLTHCIPPEI IMKGLLSELL
310 320 330 340 350
HNCDGQLKGE VAQMAAYYEH RLQLGSKAIY HLEAFVAKFM ALYKKFMEDG

LEGMMF
Length:356
Mass (Da):40,556
Last modified:December 15, 1998 - v2
Checksum:i820C11675A2C63A5
GO
Isoform 2 (identifier: P40938-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-356: GLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF → ACKEESRSCDIF

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):34,756
Checksum:i2835F2D0A4DDF1E4
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01875016L → V1 PublicationCorresponds to variant dbSNP:rs3135533Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044920294 – 356GLLSE…EGMMF → ACKEESRSCDIF in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07541 mRNA Translation: AAB07268.1
AF484446 Genomic DNA Translation: AAL82505.1
AL139081 Genomic DNA No translation available.
AL160394 Genomic DNA No translation available.
AL161891 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08537.1
BC000149 mRNA Translation: AAH00149.1
CX786577 mRNA No translation available.
CCDSiCCDS45025.1 [P40938-2]
CCDS9352.1 [P40938-1]
PIRiT09573
RefSeqiNP_002906.1, NM_002915.3 [P40938-1]
NP_853536.2, NM_181558.2 [P40938-2]
UniGeneiHs.115474
Hs.661994

Genome annotation databases

EnsembliENST00000380071; ENSP00000369411; ENSG00000133119 [P40938-1]
ENST00000434425; ENSP00000401001; ENSG00000133119 [P40938-2]
GeneIDi5983
KEGGihsa:5983
UCSCiuc001uuz.4 human [P40938-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiRFC3_HUMAN
AccessioniPrimary (citable) accession number: P40938
Secondary accession number(s): C9JU95, O15252, Q5W0E8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: December 15, 1998
Last modified: July 18, 2018
This is version 170 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health