Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P40933 (IL15_HUMAN)

Entry version 174 (16 Oct 2019)
Sequence version 1 (01 Feb 1995)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Interleukin-15

Gene

IL15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytokine that stimulates the proliferation of T-lymphocytes (PubMed:8178155). Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA (PubMed:8178155). In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation (PubMed:15123770).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8983432 Interleukin-15 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P40933

SIGNOR Signaling Network Open Resource

More...SIGNORi		P40933

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-15
Short name:
IL-15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:5977 IL15

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600554 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P40933

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		3600

Open Targets

More...OpenTargetsi		ENSG00000164136

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29790

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P40933

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3712954

Drug and drug target database

More...DrugBanki		DB01327 Cefazolin

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		IL15

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 29Sequence analysisAdd BLAST29
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000001539330 – 48Sequence analysisAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001539449 – 162Interleukin-15Add BLAST114

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi83 ↔ 1331 Publication
Disulfide bondi90 ↔ 1361 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi127N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P40933

PeptideAtlas

More...PeptideAtlasi		P40933

PRoteomics IDEntifications database

More...PRIDEi		P40933

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55387 [P40933-1]
55388 [P40933-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P40933

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P40933

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000164136 Expressed in 171 organ(s), highest expression level in decidua

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P40933 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB004457
HPA037738

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		109813, 10 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P40933

Database of interacting proteins

More...DIPi		DIP-3046N

Protein interaction database and analysis system

More...IntActi		P40933, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000296545

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1162
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P40933

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P40933

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the IL-15/IL-21 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IZ5D Eukaryota
ENOG41119SX LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000016264

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000113029

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P40933

KEGG Orthology (KO)

More...KOi		K05433

Identification of Orthologs from Complete Genome Data

More...OMAi		CKVTAMN

Database of Orthologous Groups

More...OrthoDBi		141539at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P40933

TreeFam database of animal gene trees

More...TreeFami		TF336199

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.1250.70, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009079 4_helix_cytokine-like_core
IPR020439 IL-15
IPR003443 IL-15/IL-21_fam
IPR038327 IL-15/IL-21_sf
IPR020466 IL-15_mml

The PANTHER Classification System

More...PANTHERi		PTHR14356 PTHR14356, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02372 IL15, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01947 INTLKN15MAML
PR01930 INTRLEUKIN15

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47266 SSF47266, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform IL15-S48AA (identifier: P40933-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRISKPHLRS ISIQCYLCLL LNSHFLTEAG IHVFILGCFS AGLPKTEANW 
        60         70         80         90        100
VNVISDLKKI EDLIQSMHID ATLYTESDVH PSCKVTAMKC FLLELQVISL 
       110        120        130        140        150
ESGDASIHDT VENLIILANN SLSSNGNVTE SGCKECEELE EKNIKEFLQS 
       160 
FVHIVQMFIN TS
Length:162
Mass (Da):18,086
Last modified:February 1, 1995 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0CE0520C1D8379E2
GO
Isoform IL15-S21AA (identifier: P40933-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILG → MVLGTIDLCS

Show »
Length:135
Mass (Da):14,912
Checksum:iEB44F422096B143E
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA71044 differs from that shown. Man-made cDNA with a signal peptide sequence to increase protein secretion (substitution with a signal peptide derived from the mouse IgV kappa chain).Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti141E → K in AAB97518 (PubMed:9405632).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0026601 – 37MRISK…VFILG → MVLGTIDLCS in isoform IL15-S21AA. 6 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U14407 mRNA Translation: AAA21551.1
X91233 Genomic DNA Translation: CAA62616.1
X94223 mRNA Translation: CAA63914.1
X94222 mRNA Translation: CAA63913.1
AF031167 mRNA Translation: AAB97518.1
Y09908 mRNA Translation: CAA71044.1 Sequence problems.
AY720442 mRNA Translation: AAU21241.1
AK122993 mRNA Translation: BAG53839.1
AK290619 mRNA Translation: BAF83308.1
CR541980 mRNA Translation: CAG46777.1
CR542007 mRNA Translation: CAG46804.1
CH471056 Genomic DNA Translation: EAX05083.1
CH471056 Genomic DNA Translation: EAX05084.1
CH471056 Genomic DNA Translation: EAX05085.1
CH471056 Genomic DNA Translation: EAX05086.1
CH471056 Genomic DNA Translation: EAX05087.1
BC018149 mRNA Translation: AAH18149.1
BC100961 mRNA Translation: AAI00962.1
BC100962 mRNA Translation: AAI00963.1
BC100963 mRNA Translation: AAI00964.1
Z38000 mRNA Translation: CAA86100.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3755.1 [P40933-1]
CCDS3756.1 [P40933-2]

NCBI Reference Sequences

More...RefSeqi		NP_000576.1, NM_000585.4 [P40933-1]
NP_751915.1, NM_172175.2 [P40933-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000296545; ENSP00000296545; ENSG00000164136 [P40933-1]
ENST00000320650; ENSP00000323505; ENSG00000164136 [P40933-1]
ENST00000394159; ENSP00000377714; ENSG00000164136 [P40933-2]
ENST00000477265; ENSP00000436914; ENSG00000164136 [P40933-2]
ENST00000514653; ENSP00000422271; ENSG00000164136 [P40933-2]
ENST00000529613; ENSP00000435462; ENSG00000164136 [P40933-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3600

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3600

UCSC genome browser

More...UCSCi		uc003iis.4 human [P40933-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Interleukin-15 entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U14407 mRNA Translation: AAA21551.1
X91233 Genomic DNA Translation: CAA62616.1
X94223 mRNA Translation: CAA63914.1
X94222 mRNA Translation: CAA63913.1
AF031167 mRNA Translation: AAB97518.1
Y09908 mRNA Translation: CAA71044.1 Sequence problems.
AY720442 mRNA Translation: AAU21241.1
AK122993 mRNA Translation: BAG53839.1
AK290619 mRNA Translation: BAF83308.1
CR541980 mRNA Translation: CAG46777.1
CR542007 mRNA Translation: CAG46804.1
CH471056 Genomic DNA Translation: EAX05083.1
CH471056 Genomic DNA Translation: EAX05084.1
CH471056 Genomic DNA Translation: EAX05085.1
CH471056 Genomic DNA Translation: EAX05086.1
CH471056 Genomic DNA Translation: EAX05087.1
BC018149 mRNA Translation: AAH18149.1
BC100961 mRNA Translation: AAI00962.1
BC100962 mRNA Translation: AAI00963.1
BC100963 mRNA Translation: AAI00964.1
Z38000 mRNA Translation: CAA86100.1
CCDSiCCDS3755.1 [P40933-1]
CCDS3756.1 [P40933-2]
RefSeqiNP_000576.1, NM_000585.4 [P40933-1]
NP_751915.1, NM_172175.2 [P40933-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2XQBX-ray2.60A49-162[»]
2Z3QX-ray1.85A/C49-162[»]
2Z3RX-ray2.00A/C/E/G/I/K/M/O49-162[»]
4GS7X-ray2.35A49-162[»]
SMRiP40933
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi109813, 10 interactors
CORUMiP40933
DIPiDIP-3046N
IntActiP40933, 5 interactors
STRINGi9606.ENSP00000296545

Chemistry databases

ChEMBLiCHEMBL3712954
DrugBankiDB01327 Cefazolin

PTM databases

iPTMnetiP40933
PhosphoSitePlusiP40933

Polymorphism and mutation databases

BioMutaiIL15

Proteomic databases

PaxDbiP40933
PeptideAtlasiP40933
PRIDEiP40933
ProteomicsDBi55387 [P40933-1]
55388 [P40933-2]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P40933

The DNASU plasmid repository

More...DNASUi		3600

Genome annotation databases

EnsembliENST00000296545; ENSP00000296545; ENSG00000164136 [P40933-1]
ENST00000320650; ENSP00000323505; ENSG00000164136 [P40933-1]
ENST00000394159; ENSP00000377714; ENSG00000164136 [P40933-2]
ENST00000477265; ENSP00000436914; ENSG00000164136 [P40933-2]
ENST00000514653; ENSP00000422271; ENSG00000164136 [P40933-2]
ENST00000529613; ENSP00000435462; ENSG00000164136 [P40933-1]
GeneIDi3600
KEGGihsa:3600
UCSCiuc003iis.4 human [P40933-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3600
DisGeNETi3600

GeneCards: human genes, protein and diseases

More...GeneCardsi		IL15
HGNCiHGNC:5977 IL15
HPAiCAB004457
HPA037738
MIMi600554 gene
neXtProtiNX_P40933
OpenTargetsiENSG00000164136
PharmGKBiPA29790

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IZ5D Eukaryota
ENOG41119SX LUCA
GeneTreeiENSGT00390000016264
HOGENOMiHOG000113029
InParanoidiP40933
KOiK05433
OMAiCKVTAMN
OrthoDBi141539at2759
PhylomeDBiP40933
TreeFamiTF336199

Enzyme and pathway databases

ReactomeiR-HSA-8983432 Interleukin-15 signaling
SignaLinkiP40933
SIGNORiP40933

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		IL15 human
EvolutionaryTraceiP40933

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Interleukin_15

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3600
PharosiP40933

Protein Ontology

More...PROi		PR:P40933

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000164136 Expressed in 171 organ(s), highest expression level in decidua
GenevisibleiP40933 HS

Family and domain databases

Gene3Di1.20.1250.70, 1 hit
InterProiView protein in InterPro
IPR009079 4_helix_cytokine-like_core
IPR020439 IL-15
IPR003443 IL-15/IL-21_fam
IPR038327 IL-15/IL-21_sf
IPR020466 IL-15_mml
PANTHERiPTHR14356 PTHR14356, 1 hit
PfamiView protein in Pfam
PF02372 IL15, 1 hit
PRINTSiPR01947 INTLKN15MAML
PR01930 INTRLEUKIN15
SUPFAMiSSF47266 SSF47266, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL15_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P40933
Secondary accession number(s): D3DNZ2
, O00440, O43512, Q495Z8, Q6FGX7, Q93058, Q9UBA3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: October 16, 2019
This is version 174 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again