IL15

Functionⁱ

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

GO - Molecular functionⁱ

cytokine activity Source: UniProtKB-KW
cytokine receptor binding Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

aging Source: Ensembl
cell-cell signaling
Source: ProtInc
Traceable author statementⁱ
- 7759105
cell maturation Source: Ensembl
cellular response to vitamin D Source: Ensembl
extrathymic T cell selection Source: Ensembl
hyaluronan metabolic process Source: Ensembl
immune response
Source: ProtInc
Traceable author statementⁱ
- 8178155
inflammatory response Source: Ensembl
interleukin-15-mediated signaling pathway
Source: CAFA
Inferred from direct assayⁱ
- 24942581
lymph node development Source: Ensembl
natural killer cell differentiation Source: Ensembl
negative regulation of smooth muscle cell proliferation Source: Ensembl
NK T cell proliferation Source: Ensembl
positive regulation of cell proliferation
Source: ProtInc
Traceable author statementⁱ
- 10851076
positive regulation of immune response Source: Ensembl
positive regulation of inflammatory response
Source: BHF-UCL
Inferred by curatorⁱ
- 16482511
positive regulation of interleukin-17 production
Source: BHF-UCL
Inferred from direct assayⁱ
- 16482511
positive regulation of natural killer cell differentiation Source: Ensembl
positive regulation of natural killer cell proliferation Source: Ensembl
positive regulation of protein O-linked glycosylation Source: Ensembl
positive regulation of T cell proliferation Source: Ensembl
positive regulation of tissue remodeling
Source: BHF-UCL
Inferred by curatorⁱ
- 16482511
positive regulation of tyrosine phosphorylation of STAT protein Source: Ensembl
regulation of defense response to virus by host Source: Ensembl
regulation of T cell differentiation Source: Ensembl
signal transduction
Source: ProtInc
Traceable author statementⁱ
- 8178155
skeletal muscle atrophy Source: Ensembl
tyrosine phosphorylation of STAT protein
Source: CACAO
Inferred from direct assayⁱ
- 12244150

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Cytokine

Molecular function

Cytokine

Enzyme and pathway databases

Reactomeⁱ	R-HSA-8983432 Interleukin-15 signaling
SignaLinkⁱ	P40933
SIGNORⁱ	P40933

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Interleukin-15 Short name: IL-15
Gene namesⁱ	Name:IL15
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 4

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000164136.16
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:5977 IL15
MIMⁱ	600554 gene
neXtProtⁱ	NX_P40933

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus, Secreted

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	3600
Open Targets More...OpenTargetsⁱ	ENSG00000164136
PharmGKBⁱ	PA29790

Chemistry databases

ChEMBLⁱ	CHEMBL3712954

ChEMBLⁱ

CHEMBL3712954

Polymorphism and mutation databases

BioMutaⁱ	IL15

BioMutaⁱ

IL15

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Length
Signal peptideⁱ	1 – 29	Sequence analysisAdd BLAST	29
PropeptideⁱPRO_0000015393	30 – 48	Sequence analysisAdd BLAST	19
ChainⁱPRO_0000015394	49 – 162	Interleukin-15Add BLAST	114

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	83 ↔ 133	1 Publication
Disulfide bondⁱ	90 ↔ 136	1 Publication
Glycosylationⁱ	127	N-linked (GlcNAc...) asparagineSequence analysis	1

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbⁱ	P40933
PeptideAtlas More...PeptideAtlasⁱ	P40933
PRIDEⁱ	P40933
ProteomicsDBⁱ	55387 55388 [P40933-2]

PTM databases

iPTMnetⁱ	P40933
PhosphoSitePlusⁱ	P40933

Expressionⁱ

Tissue specificityⁱ

Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.

Gene expression databases

Bgeeⁱ	ENSG00000164136
CleanExⁱ	HS_IL15
Genevisibleⁱ	P40933 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB004457 HPA037738

HPAⁱ

CAB004457
HPA037738

Interactionⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
IL15RA	Q13261	5	EBI-980274,EBI-980354
IL2RB	P14784	3	EBI-980274,EBI-2866779

Show more details

GO - Molecular functionⁱ

cytokine activity Source: UniProtKB-KW
cytokine receptor binding Source: InterPro

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	109813, 10 interactors
Database of interacting proteins More...DIPⁱ	DIP-3046N
IntActⁱ	P40933, 5 interactors
STRINGⁱ	9606.ENSP00000296545

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Show more details

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	49 – 64	Combined sources	16
Beta strandⁱ	73 – 75	Combined sources	3
Helixⁱ	81 – 83	Combined sources	3
Helixⁱ	84 – 102	Combined sources	19
Helixⁱ	105 – 119	Combined sources	15
Helixⁱ	136 – 138	Combined sources	3
Beta strandⁱ	139 – 142	Combined sources	4
Helixⁱ	144 – 158	Combined sources	15

3D structure databases

ProteinModelPortalⁱ	P40933
SMRⁱ	P40933
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P40933

EvolutionaryTraceⁱ

P40933

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the IL-15/IL-21 family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	ENOG410IZ5D Eukaryota ENOG41119SX LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000016264
HOGENOMⁱ	HOG000113029
HOVERGENⁱ	HBG006142
InParanoidⁱ	P40933
KEGG Orthology (KO) More...KOⁱ	K05433
OMAⁱ	TSIQCYL
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0VGG
PhylomeDBⁱ	P40933
TreeFamⁱ	TF336199

Family and domain databases

Gene3Dⁱ	1.20.1250.70, 1 hit
InterProⁱ	View protein in InterPro IPR009079 4_helix_cytokine-like_core IPR020439 IL-15 IPR003443 IL-15/IL-21_fam IPR038327 IL-15/IL-21_sf IPR020466 IL-15_mml
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF02372 IL15, 1 hit
PRINTSⁱ	PR01947 INTLKN15MAML PR01930 INTRLEUKIN15
SUPFAMⁱ	SSF47266 SSF47266, 1 hit

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket Added to basket

Isoform IL15-S48AA (identifier: P40933-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRISKPHLRS ISIQCYLCLL LNSHFLTEAG IHVFILGCFS AGLPKTEANW 
        60         70         80         90        100
VNVISDLKKI EDLIQSMHID ATLYTESDVH PSCKVTAMKC FLLELQVISL 
       110        120        130        140        150
ESGDASIHDT VENLIILANN SLSSNGNVTE SGCKECEELE EKNIKEFLQS 
       160 
FVHIVQMFIN TS

Length:162

Mass (Da):18,086

Last modified:February 1, 1995 - v1

Checksum:ⁱ0CE0520C1D8379E2

GO

Isoform IL15-S21AA (identifier: P40933-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-37: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILG → MVLGTIDLCS

« Hide

        10         20         30         40         50
MVLGTIDLCS CFSAGLPKTE ANWVNVISDL KKIEDLIQSM HIDATLYTES 
        60         70         80         90        100
DVHPSCKVTA MKCFLLELQV ISLESGDASI HDTVENLIIL ANNSLSSNGN 
       110        120        130 
VTESGCKECE ELEEKNIKEF LQSFVHIVQM FINTS

Show »

Length:135

Mass (Da):14,912

Checksum:ⁱEB44F422096B143E

GO

Sequence cautionⁱ

The sequence CAA71044 differs from that shown. Man-made cDNA with a signal peptide sequence to increase protein secretion (substitution with a signal peptide derived from the mouse IgV kappa chain).Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	141	E → K in AAB97518 (PubMed:9405632).Curated		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_002660	1 – 37	MRISK…VFILG → MVLGTIDLCS in isoform IL15-S21AA. 6 PublicationsAdd BLAST		37

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U14407 mRNA Translation: AAA21551.1 X91233 Genomic DNA Translation: CAA62616.1 X94223 mRNA Translation: CAA63914.1 X94222 mRNA Translation: CAA63913.1 AF031167 mRNA Translation: AAB97518.1 Y09908 mRNA Translation: CAA71044.1 Sequence problems. AY720442 mRNA Translation: AAU21241.1 AK122993 mRNA Translation: BAG53839.1 AK290619 mRNA Translation: BAF83308.1 CR541980 mRNA Translation: CAG46777.1 CR542007 mRNA Translation: CAG46804.1 CH471056 Genomic DNA Translation: EAX05083.1 CH471056 Genomic DNA Translation: EAX05084.1 CH471056 Genomic DNA Translation: EAX05085.1 CH471056 Genomic DNA Translation: EAX05086.1 CH471056 Genomic DNA Translation: EAX05087.1 BC018149 mRNA Translation: AAH18149.1 BC100961 mRNA Translation: AAI00962.1 BC100962 mRNA Translation: AAI00963.1 BC100963 mRNA Translation: AAI00964.1 Z38000 mRNA Translation: CAA86100.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS3755.1 [P40933-1] CCDS3756.1 [P40933-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_000576.1, NM_000585.4 [P40933-1] NP_751915.1, NM_172175.2 [P40933-2]
UniGeneⁱ	Hs.168132 Hs.602618 Hs.735901

Genome annotation databases

Ensemblⁱ	ENST00000296545; ENSP00000296545; ENSG00000164136 [P40933-1] ENST00000320650; ENSP00000323505; ENSG00000164136 [P40933-1] ENST00000394159; ENSP00000377714; ENSG00000164136 [P40933-2] ENST00000477265; ENSP00000436914; ENSG00000164136 [P40933-2] ENST00000514653; ENSP00000422271; ENSG00000164136 [P40933-2] ENST00000529613; ENSP00000435462; ENSG00000164136 [P40933-1]
GeneIDⁱ	3600
KEGGⁱ	hsa:3600
UCSC genome browser More...UCSCⁱ	uc003iis.4 human [P40933-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length
P40933	Interleukin		PANTR		162
Interleukin		PANPA		162
UPI00001444CD		HUMAN		114
P40933-2	Interleukin		PANTR		135
Interleukin		PANPA		135

Protein	Similar proteins		Species	Score	Length
P40933	Interleukin		PANTR		162
Interleukin		PANPA		162
UPI00001444CD		HUMAN		114
Interleukin		PONAB		162
Interleukin		CHLSB		162
+10

Protein	Similar proteins		Species	Score	Length
P40933	Interleukin		PANTR		162
Interleukin		PANPA		162
UPI00001444CD		HUMAN		114
Interleukin		CHLSB		162
Interleukin		GORGO		162
+37

Cross-referencesⁱ

Web resourcesⁱ

Wikipedia

Interleukin-15 entry

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U14407 mRNA Translation: AAA21551.1 X91233 Genomic DNA Translation: CAA62616.1 X94223 mRNA Translation: CAA63914.1 X94222 mRNA Translation: CAA63913.1 AF031167 mRNA Translation: AAB97518.1 Y09908 mRNA Translation: CAA71044.1 Sequence problems. AY720442 mRNA Translation: AAU21241.1 AK122993 mRNA Translation: BAG53839.1 AK290619 mRNA Translation: BAF83308.1 CR541980 mRNA Translation: CAG46777.1 CR542007 mRNA Translation: CAG46804.1 CH471056 Genomic DNA Translation: EAX05083.1 CH471056 Genomic DNA Translation: EAX05084.1 CH471056 Genomic DNA Translation: EAX05085.1 CH471056 Genomic DNA Translation: EAX05086.1 CH471056 Genomic DNA Translation: EAX05087.1 BC018149 mRNA Translation: AAH18149.1 BC100961 mRNA Translation: AAI00962.1 BC100962 mRNA Translation: AAI00963.1 BC100963 mRNA Translation: AAI00964.1 Z38000 mRNA Translation: CAA86100.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS3755.1 [P40933-1] CCDS3756.1 [P40933-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_000576.1, NM_000585.4 [P40933-1] NP_751915.1, NM_172175.2 [P40933-2]
UniGeneⁱ	Hs.168132 Hs.602618 Hs.735901

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2XQB	X-ray	2.60	A	49-162	[»]
	2Z3Q	X-ray	1.85	A/C	49-162	[»]
	2Z3R	X-ray	2.00	A/C/E/G/I/K/M/O	49-162	[»]
	4GS7	X-ray	2.35	A	49-162	[»]
ProteinModelPortalⁱ	P40933
SMRⁱ	P40933
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	109813, 10 interactors
Database of interacting proteins More...DIPⁱ	DIP-3046N
IntActⁱ	P40933, 5 interactors
STRINGⁱ	9606.ENSP00000296545

Chemistry databases

ChEMBLⁱ	CHEMBL3712954

ChEMBLⁱ

CHEMBL3712954

PTM databases

iPTMnetⁱ	P40933
PhosphoSitePlusⁱ	P40933

Polymorphism and mutation databases

BioMutaⁱ	IL15

BioMutaⁱ

IL15

Proteomic databases

PaxDbⁱ	P40933
PeptideAtlas More...PeptideAtlasⁱ	P40933
PRIDEⁱ	P40933
ProteomicsDBⁱ	55387 55388 [P40933-2]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	3600
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000296545; ENSP00000296545; ENSG00000164136 [P40933-1] ENST00000320650; ENSP00000323505; ENSG00000164136 [P40933-1] ENST00000394159; ENSP00000377714; ENSG00000164136 [P40933-2] ENST00000477265; ENSP00000436914; ENSG00000164136 [P40933-2] ENST00000514653; ENSP00000422271; ENSG00000164136 [P40933-2] ENST00000529613; ENSP00000435462; ENSG00000164136 [P40933-1]
GeneIDⁱ	3600
KEGGⁱ	hsa:3600
UCSC genome browser More...UCSCⁱ	uc003iis.4 human [P40933-1]

Organism-specific databases

CTDⁱ	3600
DisGeNET More...DisGeNETⁱ	3600
EuPathDBⁱ	HostDB:ENSG00000164136.16
GeneCardsⁱ	IL15
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:5977 IL15
Human Protein Atlas More...HPAⁱ	CAB004457 HPA037738
MIMⁱ	600554 gene
neXtProtⁱ	NX_P40933
Open Targets More...OpenTargetsⁱ	ENSG00000164136
PharmGKBⁱ	PA29790
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IZ5D Eukaryota ENOG41119SX LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000016264
HOGENOMⁱ	HOG000113029
HOVERGENⁱ	HBG006142
InParanoidⁱ	P40933
KEGG Orthology (KO) More...KOⁱ	K05433
OMAⁱ	TSIQCYL
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0VGG
PhylomeDBⁱ	P40933
TreeFamⁱ	TF336199

Enzyme and pathway databases

Reactomeⁱ	R-HSA-8983432 Interleukin-15 signaling
SignaLinkⁱ	P40933
SIGNORⁱ	P40933

Miscellaneous databases

ChiTaRSⁱ	IL15 human
EvolutionaryTraceⁱ	P40933
GeneWikiⁱ	Interleukin_15
GenomeRNAiⁱ	3600
Protein Ontology More...PROⁱ	PR:P40933
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000164136
CleanExⁱ	HS_IL15
Genevisibleⁱ	P40933 HS

Family and domain databases

Gene3Dⁱ	1.20.1250.70, 1 hit
InterProⁱ	View protein in InterPro IPR009079 4_helix_cytokine-like_core IPR020439 IL-15 IPR003443 IL-15/IL-21_fam IPR038327 IL-15/IL-21_sf IPR020466 IL-15_mml
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF02372 IL15, 1 hit
PRINTSⁱ	PR01947 INTLKN15MAML PR01930 INTRLEUKIN15
SUPFAMⁱ	SSF47266 SSF47266, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	IL15_HUMAN
Accessionⁱ	P40933Primary (citable) accession number: P40933 Secondary accession number(s): D3DNZ2 Q9UBA3
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1995
	Last sequence update:	February 1, 1995
	Last modified:	July 18, 2018
	This is version 162 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human chromosome 4
Human chromosome 4: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
SIMILARITY comments
Index of protein domains and families

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P40933 (IL15_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Interleukin-15

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Nucleus

Other locations

Cytosol

Endosome

Extracellular region or secreted

Golgi apparatus

Nucleus

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ