Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (17 Jun 2020)
Sequence version 2 (28 Nov 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

S-adenosylmethionine synthase

Gene

Sam-S

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: S-adenosyl-L-methionine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes S-adenosyl-L-methionine from L-methionine.By similarity
Proteins known to be involved in this subpathway in this organism are:
  1. S-adenosylmethionine synthase (Sam-S), S-adenosylmethionine synthase (Sam-S), S-adenosylmethionine synthase (M(2)21AB-RG), S-adenosylmethionine synthase (M(2)21AB-RB)
This subpathway is part of the pathway S-adenosyl-L-methionine biosynthesis, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes S-adenosyl-L-methionine from L-methionine, the pathway S-adenosyl-L-methionine biosynthesis and in Amino-acid biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi34MagnesiumBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei40ATPBy similarity1
Metal bindingi68PotassiumBy similarity1
Binding sitei81MethionineBy similarity1
Binding sitei124MethionineBy similarity1
Binding sitei269ATPBy similarity1
Binding sitei269Methionine; shared with neighboring subunitBy similarity1
Binding sitei292ATP; via amide nitrogen; shared with neighboring subunitBy similarity1
Binding sitei296ATP; shared with neighboring subunitBy similarity1
Binding sitei300ATP; shared with neighboring subunitBy similarity1
Binding sitei300MethionineBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi190 – 192ATPBy similarity3
Nucleotide bindingi258 – 261ATPBy similarity4
Nucleotide bindingi275 – 276ATPBy similarity2

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processOne-carbon metabolism
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Potassium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-156581 Methylation
R-DME-1614635 Sulfur amino acid metabolism
R-DME-2408508 Metabolism of ingested SeMet, Sec, MeSec into H2Se

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00315;UER00080

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
S-adenosylmethionine synthase (EC:2.5.1.6By similarity)
Short name:
AdoMet synthase
Alternative name(s):
Methionine adenosyltransferase
Short name:
MAT
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sam-S
Synonyms:M(2)21AB, SamS
ORF Names:CG2674
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0005278 Sam-S

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001744461 – 408S-adenosylmethionine synthaseAdd BLAST408

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P40320

PRoteomics IDEntifications database

More...
PRIDEi
P40320

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed both maternally and zygotically. Expressed throughout development with highest levels at adult stages.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0005278 Expressed in egg chamber and 47 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P40320 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P40320 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
71491, 26 interactors

Database of interacting proteins

More...
DIPi
DIP-18340N

Protein interaction database and analysis system

More...
IntActi
P40320, 9 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0088926

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P40320

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AdoMet synthase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1506 Eukaryota
COG0192 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183185

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_041802_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P40320

KEGG Orthology (KO)

More...
KOi
K00789

Identification of Orthologs from Complete Genome Data

More...
OMAi
MPYLRPD

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P40320

Family and domain databases

HAMAP database of protein families

More...
HAMAPi
MF_00086 S_AdoMet_synth1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022631 ADOMET_SYNTHASE_CS
IPR022630 S-AdoMet_synt_C
IPR022629 S-AdoMet_synt_central
IPR022628 S-AdoMet_synt_N
IPR002133 S-AdoMet_synthetase
IPR022636 S-AdoMet_synthetase_sfam

The PANTHER Classification System

More...
PANTHERi
PTHR11964 PTHR11964, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02773 S-AdoMet_synt_C, 1 hit
PF02772 S-AdoMet_synt_M, 1 hit
PF00438 S-AdoMet_synt_N, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000497 MAT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55973 SSF55973, 3 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01034 metK, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00376 ADOMET_SYNTHASE_1, 1 hit
PS00377 ADOMET_SYNTHASE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P40320-1) [UniParc]FASTAAdd to basket
Also known as: A, D

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPQKTNGHSA NGCNGSNGNS YDMEDGATFL FTSESVGEGH PDKMCDQISD
60 70 80 90 100
AILDAHLKQD PNAKVACETV AKTGMILLCG EITSKAVVDY QKVVRETVQH
110 120 130 140 150
IGYDDSSKGF DFKTCNVLLA LDQQSPEIAA GVHVNRAEEE IGAGDQGIMF
160 170 180 190 200
GYATDETEEC MPLTVVLAHK LNEKIAELRR SDVFWWARPD SKTQVTCEYL
210 220 230 240 250
FNQGSAVPKR VHTIVVSMQH SEKISLETLR SEVMEKVVKV VIPAKYIDAN
260 270 280 290 300
TIVHINPCGL FVIGGPMGDA GLTGRKIIVD TYGGWGAHGG GAFSGKDFTK
310 320 330 340 350
VDRSAAYAAR WVAKSLVKAG LCKRCLVQVS YAIGLAEPLS ITVFDYGTSH
360 370 380 390 400
KSQKELLDII RRNFDLRPGK IVKDLNLRQP IYQRTSTYGH FGRAGFSWEE

AKPLEIDN
Length:408
Mass (Da):44,697
Last modified:November 28, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCA0F97C1EA6623DF
GO
Isoform 1 (identifier: P40320-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     112-141: FKTCNVLLALDQQSPEIAAGVHVNRAEEEI → WKTLNLLVAIEQQSPNIANGVHINREEEDV
     147-200: GIMFGYATDE...SKTQVTCEYL → VSISKRAMCC...PPTKPRNVCP
     201-408: Missing.

Show »
Length:200
Mass (Da):22,037
Checksum:i85332A5181EC863B
GO
Isoform 3 (identifier: P40320-3) [UniParc]FASTAAdd to basket
Also known as: C, J

The sequence of this isoform differs from the canonical sequence as follows:
     112-141: FKTCNVLLALDQQSPEIAAGVHVNRAEEEI → WKTLNLLVAIEQQSPNIANGVHINREEEDV

Show »
Length:408
Mass (Da):44,832
Checksum:i0E0BA875821D15EA
GO
Isoform 4 (identifier: P40320-4) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     28-41: TFLFTSESVGEGHP → MISAECHSEEYTPN
     112-141: FKTCNVLLALDQQSPEIAAGVHVNRAEEEI → WKTLNLLVAIEQQSPNIANGVHINREEEDV

Show »
Length:381
Mass (Da):42,196
Checksum:i3A1BDEB76C5ECE3D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A4UZW2A4UZW2_DROME
S-adenosylmethionine synthase
Sam-S Dmel\CG2674, M(2)21A-B, M(2)21AB, m(2)21ab, METK
408Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E4NKH6E4NKH6_DROME
MIP27448p
Sam-S Dmel\CG2674, M(2)21A-B, M(2)21AB, m(2)21ab, M(2)21AB-RB
115Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PAY2M9PAY2_DROME
S-adenosylmethionine synthetase, is...
Sam-S Dmel\CG2674, M(2)21A-B, M(2)21AB, m(2)21ab, METK
138Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti34E → V in CAA54567 (PubMed:8150093).Curated1
Sequence conflicti94V → I in CAA54567 (PubMed:8150093).Curated1
Sequence conflicti290G → A in CAA54567 (PubMed:8150093).Curated1
Sequence conflicti400 – 408EAKPLEIDN → SQASGD in CAA54567 (PubMed:8150093).Curated9

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0059611 – 27Missing in isoform 4. CuratedAdd BLAST27
Alternative sequenceiVSP_00596228 – 41TFLFT…GEGHP → MISAECHSEEYTPN in isoform 4. CuratedAdd BLAST14
Alternative sequenceiVSP_005963112 – 141FKTCN…AEEEI → WKTLNLLVAIEQQSPNIANG VHINREEEDV in isoform 1, isoform 3 and isoform 4. CuratedAdd BLAST30
Alternative sequenceiVSP_005964147 – 200GIMFG…TCEYL → VSISKRAMCCWHWTNNRLRS LRECMSTVPRKRSVPEIRVS CLDMPPTKPRNVCP in isoform 1. CuratedAdd BLAST54
Alternative sequenceiVSP_005965201 – 408Missing in isoform 1. CuratedAdd BLAST208

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X77392 mRNA Translation: CAA54567.1
AE014134 Genomic DNA Translation: AAF51555.1
AE014134 Genomic DNA Translation: AAF51556.1
AE014134 Genomic DNA Translation: AAF51557.1
AE014134 Genomic DNA Translation: AAF51558.1
AE014134 Genomic DNA Translation: AAN10505.1
AE014134 Genomic DNA Translation: AAN10506.1
AE014134 Genomic DNA Translation: AAN10507.1
AE014134 Genomic DNA Translation: AAS64636.1
AY051918 mRNA Translation: AAK93342.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S43258 S41917

NCBI Reference Sequences

More...
RefSeqi
NP_524923.1, NM_080184.2 [P40320-3]
NP_722593.1, NM_164355.3 [P40320-3]
NP_722594.1, NM_164356.2 [P40320-1]
NP_722595.1, NM_164357.2 [P40320-1]
NP_722596.1, NM_164358.2 [P40320-1]
NP_722597.1, NM_164359.2 [P40320-1]
NP_722598.1, NM_164360.3 [P40320-1]
NP_722599.1, NM_164361.2 [P40320-2]
NP_722600.1, NM_164362.3 [P40320-4]
NP_995602.1, NM_205880.1 [P40320-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0089428; FBpp0088444; FBgn0005278 [P40320-2]
FBtr0089429; FBpp0088445; FBgn0005278 [P40320-1]
FBtr0089430; FBpp0088446; FBgn0005278 [P40320-1]
FBtr0089431; FBpp0088447; FBgn0005278 [P40320-3]
FBtr0089432; FBpp0088448; FBgn0005278 [P40320-1]
FBtr0089433; FBpp0088449; FBgn0005278 [P40320-1]
FBtr0089434; FBpp0088450; FBgn0005278 [P40320-1]
FBtr0089435; FBpp0088451; FBgn0005278 [P40320-3]
FBtr0089436; FBpp0088452; FBgn0005278 [P40320-4]
FBtr0089437; FBpp0088926; FBgn0005278 [P40320-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
48552

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG2674

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X77392 mRNA Translation: CAA54567.1
AE014134 Genomic DNA Translation: AAF51555.1
AE014134 Genomic DNA Translation: AAF51556.1
AE014134 Genomic DNA Translation: AAF51557.1
AE014134 Genomic DNA Translation: AAF51558.1
AE014134 Genomic DNA Translation: AAN10505.1
AE014134 Genomic DNA Translation: AAN10506.1
AE014134 Genomic DNA Translation: AAN10507.1
AE014134 Genomic DNA Translation: AAS64636.1
AY051918 mRNA Translation: AAK93342.1
PIRiS43258 S41917
RefSeqiNP_524923.1, NM_080184.2 [P40320-3]
NP_722593.1, NM_164355.3 [P40320-3]
NP_722594.1, NM_164356.2 [P40320-1]
NP_722595.1, NM_164357.2 [P40320-1]
NP_722596.1, NM_164358.2 [P40320-1]
NP_722597.1, NM_164359.2 [P40320-1]
NP_722598.1, NM_164360.3 [P40320-1]
NP_722599.1, NM_164361.2 [P40320-2]
NP_722600.1, NM_164362.3 [P40320-4]
NP_995602.1, NM_205880.1 [P40320-1]

3D structure databases

SMRiP40320
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi71491, 26 interactors
DIPiDIP-18340N
IntActiP40320, 9 interactors
STRINGi7227.FBpp0088926

Proteomic databases

PaxDbiP40320
PRIDEiP40320

Genome annotation databases

EnsemblMetazoaiFBtr0089428; FBpp0088444; FBgn0005278 [P40320-2]
FBtr0089429; FBpp0088445; FBgn0005278 [P40320-1]
FBtr0089430; FBpp0088446; FBgn0005278 [P40320-1]
FBtr0089431; FBpp0088447; FBgn0005278 [P40320-3]
FBtr0089432; FBpp0088448; FBgn0005278 [P40320-1]
FBtr0089433; FBpp0088449; FBgn0005278 [P40320-1]
FBtr0089434; FBpp0088450; FBgn0005278 [P40320-1]
FBtr0089435; FBpp0088451; FBgn0005278 [P40320-3]
FBtr0089436; FBpp0088452; FBgn0005278 [P40320-4]
FBtr0089437; FBpp0088926; FBgn0005278 [P40320-1]
GeneIDi48552
KEGGidme:Dmel_CG2674

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
48552
FlyBaseiFBgn0005278 Sam-S

Phylogenomic databases

eggNOGiKOG1506 Eukaryota
COG0192 LUCA
GeneTreeiENSGT00950000183185
HOGENOMiCLU_041802_0_1_1
InParanoidiP40320
KOiK00789
OMAiMPYLRPD
PhylomeDBiP40320

Enzyme and pathway databases

UniPathwayiUPA00315;UER00080
ReactomeiR-DME-156581 Methylation
R-DME-1614635 Sulfur amino acid metabolism
R-DME-2408508 Metabolism of ingested SeMet, Sec, MeSec into H2Se

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
48552 1 hit in 5 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sam-S fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
48552

Protein Ontology

More...
PROi
PR:P40320

Gene expression databases

BgeeiFBgn0005278 Expressed in egg chamber and 47 other tissues
ExpressionAtlasiP40320 baseline and differential
GenevisibleiP40320 DM

Family and domain databases

HAMAPiMF_00086 S_AdoMet_synth1, 1 hit
InterProiView protein in InterPro
IPR022631 ADOMET_SYNTHASE_CS
IPR022630 S-AdoMet_synt_C
IPR022629 S-AdoMet_synt_central
IPR022628 S-AdoMet_synt_N
IPR002133 S-AdoMet_synthetase
IPR022636 S-AdoMet_synthetase_sfam
PANTHERiPTHR11964 PTHR11964, 1 hit
PfamiView protein in Pfam
PF02773 S-AdoMet_synt_C, 1 hit
PF02772 S-AdoMet_synt_M, 1 hit
PF00438 S-AdoMet_synt_N, 1 hit
PIRSFiPIRSF000497 MAT, 1 hit
SUPFAMiSSF55973 SSF55973, 3 hits
TIGRFAMsiTIGR01034 metK, 1 hit
PROSITEiView protein in PROSITE
PS00376 ADOMET_SYNTHASE_1, 1 hit
PS00377 ADOMET_SYNTHASE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMETK_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P40320
Secondary accession number(s): Q0E8V3
, Q9VPJ2, Q9VPJ3, Q9VPJ4, Q9VPJ5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: November 28, 2002
Last modified: June 17, 2020
This is version 178 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again